KEGG   Desmodus rotundus (common vampire bat): 112309970
Entry
112309970         CDS       T05907                                 

Gene name
TGFBR2
Definition
(RefSeq) TGF-beta receptor type-2
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04010  MAPK signaling pathway
dro04060  Cytokine-cytokine receptor interaction
dro04068  FoxO signaling pathway
dro04144  Endocytosis
dro04218  Cellular senescence
dro04350  TGF-beta signaling pathway
dro04380  Osteoclast differentiation
dro04390  Hippo signaling pathway
dro04520  Adherens junction
dro04659  Th17 cell differentiation
dro04926  Relaxin signaling pathway
dro04933  AGE-RAGE signaling pathway in diabetic complications
dro05142  Chagas disease
dro05161  Hepatitis B
dro05166  Human T-cell leukemia virus 1 infection
dro05200  Pathways in cancer
dro05202  Transcriptional misregulation in cancer
dro05210  Colorectal cancer
dro05212  Pancreatic cancer
dro05220  Chronic myeloid leukemia
dro05225  Hepatocellular carcinoma
dro05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112309970 (TGFBR2)
   04350 TGF-beta signaling pathway
    112309970 (TGFBR2)
   04390 Hippo signaling pathway
    112309970 (TGFBR2)
   04068 FoxO signaling pathway
    112309970 (TGFBR2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    112309970 (TGFBR2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112309970 (TGFBR2)
  09143 Cell growth and death
   04218 Cellular senescence
    112309970 (TGFBR2)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    112309970 (TGFBR2)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    112309970 (TGFBR2)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    112309970 (TGFBR2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    112309970 (TGFBR2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112309970 (TGFBR2)
   05202 Transcriptional misregulation in cancer
    112309970 (TGFBR2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112309970 (TGFBR2)
   05212 Pancreatic cancer
    112309970 (TGFBR2)
   05225 Hepatocellular carcinoma
    112309970 (TGFBR2)
   05226 Gastric cancer
    112309970 (TGFBR2)
   05220 Chronic myeloid leukemia
    112309970 (TGFBR2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    112309970 (TGFBR2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112309970 (TGFBR2)
   05161 Hepatitis B
    112309970 (TGFBR2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    112309970 (TGFBR2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dro01001]
    112309970 (TGFBR2)
Enzymes [BR:dro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     112309970 (TGFBR2)
Protein kinases [BR:dro01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   112309970 (TGFBR2)
SSDB
Motif
Pfam: ecTbetaR2 PK_Tyr_Ser-Thr Pkinase Pkinase_fungal APH
Other DBs
NCBI-GeneID: 112309970
NCBI-ProteinID: XP_024421987
LinkDB
Position
Unknown
AA seq 567 aa
MGRGLLRGLWPLHIVLWTRIASTIPPHVQKAVNNDMMITDNNGAVKFPQLCKFCDVRSST
CDSRKSCLSNCSITSICEKPHEVCVAVWRKNDENITLETVCHDPKVPYHGFILEDAASPK
CIMKEKKVNGETFFMCACSAEECNDHIIFSEEYSTNNPDLWLVVFQVTGVSLLPPLVIAI
AVIIAFYCYRVHRKQKLTPSWDTSKPRKLMDLSEHLAIILEDDRSDISSTCANNINHNTE
LLPIELDTLVGKGRFAEVYKAKLKQNTSEQFETVAVKIFPYEEYASWKMEKDIFSDINLK
HENILQFLTAEERKTELGKQYWLITAFHAKGNLQEYLTRHVISWEDLCKLGSSLARGIAH
LHSDHTLCGRPKMPIVHRDLKSSNILVKNDLTCCLCDFGLSLRLDPTLSVDDLANSGQVG
TARYMAPEVLESRMNLENVESFKQTDVYSMALVLWEMTSRCNAVGEVKEYEPPFGSKVRE
HPCVESMKDNVLRDRGRPEIPSSWLNHQGIQMVCETLTECWDHDPEARLTAQCVAERFSE
LEHLDRLSGRSCSEEKIPEDGSLGTTK
NT seq 1704 nt   +upstreamnt  +downstreamnt
atgggtcgggggctgctcaggggcctgtggcctctgcacatcgtcctgtggacgcgcatc
gccagcacgatccctccgcacgttcagaaggcggttaacaatgacatgatgatcactgac
aacaacggtgcagtcaagtttccacaactgtgcaaattctgtgatgtgaggtcctccacc
tgtgacagtcgcaagtcctgcctgagcaactgcagcatcacatccatctgcgagaagcca
cacgaggtctgtgtggctgtctggaggaagaatgatgagaacataacactagagacggtt
tgccacgaccccaaggtcccctaccatggatttattctcgaagatgctgcttctccaaag
tgtattatgaaggaaaaaaaagtgaatggcgagactttctttatgtgcgcctgtagcgct
gaagagtgcaatgaccacatcatcttctctgaagaatattccaccaacaaccctgacttg
tggttagtcgtattccaagtgacgggcgtcagcctcctgccacccctggtcattgccata
gctgtcattattgccttttactgctaccgtgttcaccgaaagcagaagctgaccccatcc
tgggataccagcaagccacggaagctcatggacctcagtgagcaccttgccatcattctg
gaagacgaccgctccgacatcagctccacgtgtgccaacaacatcaaccacaacacggag
cttctgcccattgagctggacaccctggtggggaaagggcgctttgccgaggtctacaag
gccaagctgaagcagaacacctcagagcagtttgagaccgtggcagtcaagatcttccct
tatgaggagtatgcttcttggaagatggagaaggacattttctcagacatcaacctaaag
catgagaacatcctccagttcctgacggccgaggagcggaagacagagttggggaagcag
tactggctgatcactgctttccatgccaagggcaacctacaggagtacctcacgagacat
gtcatcagctgggaggacctgtgcaagctaggtagctcccttgccaggggcatagctcac
ctgcacagtgaccacaccctgtgtgggaggcccaagatgcccatagtgcacagggacctc
aagagctccaatatcctcgtgaagaatgacctgacctgctgcctgtgtgactttgggctt
tccctgcgcctagaccccactctgtctgtggatgacttggccaacagtgggcaggtggga
actgcgagatatatggccccagaagtcctagagtccaggatgaacttggagaacgtggag
tccttcaagcagacggatgtctactccatggcgctggtgctctgggaaatgacgtctcgc
tgtaatgcagtgggagaagtgaaagagtatgagcctccctttggttccaaggtgcgggag
cacccctgcgttgaaagcatgaaggacaacgtgttgagagatcggggtcgaccggaaatt
cccagctcctggctcaaccaccagggcatccagatggtgtgtgagacgctgaccgagtgc
tgggaccacgacccagaggcccgtctcacggcccagtgtgtggcggagcgcttcagcgag
ctggagcacctggacaggctctcggggaggagctgctccgaggagaagattcccgaagat
ggctcgctgggcactaccaaatag

DBGET integrated database retrieval system