KEGG   Desmodus rotundus (common vampire bat): 112309976
Entry
112309976         CDS       T05907                                 

Gene name
RARB
Definition
(RefSeq) retinoic acid receptor beta isoform X1
  KO
K08528  retinoic acid receptor beta
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro05200  Pathways in cancer
dro05222  Small cell lung cancer
dro05223  Non-small cell lung cancer
dro05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112309976 (RARB)
  09162 Cancer: specific types
   05226 Gastric cancer
    112309976 (RARB)
   05222 Small cell lung cancer
    112309976 (RARB)
   05223 Non-small cell lung cancer
    112309976 (RARB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dro03000]
    112309976 (RARB)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:dro03310]
    112309976 (RARB)
Transcription factors [BR:dro03000]
 Eukaryotic type
  Zinc finger
   Cys4 thyroid hormone receptor-like
    112309976 (RARB)
Nuclear receptors [BR:dro03310]
 1. Thyroid hormone like
  1B. Retinoic acid receptor (RAR)
   112309976 (RARB)
SSDB
Motif
Pfam: zf-C4 Hormone_recep
Other DBs
NCBI-GeneID: 112309976
NCBI-ProteinID: XP_024421992
LinkDB
Position
Unknown
AA seq 475 aa
MFDCMDVLSVSPGQILDFYTASPSSCMLQEKALKACFSGLTQTEWQHRHTAQSVNLHKQF
CEGSMIVLIFQKRNLRLREAIETQSTSSEELVPSPPSPLPPPRVYKPCFVCQDKSSGYHY
GVSACEGCKGFFRRSIQKNMIYTCHRDKNCVINKVTRNRCQYCRLQKCFEVGMSKESVRN
DRNKKKKEPSKQECTESYEMTAELDDLTEKIRKAHQETFPSLCQLGKYTTNSSADHRVRL
DLGLWDKFSELATKCIIKIVEFAKRLPGFTSLTIADQITLLKAACLDILILRICTRYTPE
QDTMTFSDGLTLNRTQMHNAGFGPLTDLVFTFANQLLPLEMDDTETGLLSAICLICGDRQ
DLEEPTKVDKLQEPLLEALKIYIRKRRPSKPHMFPKILMKITDLRSISAKGAERVITLKM
EIPGSMPPLIQEMLENSEGHEPLTPSSSGNTAEHSPSISPSSVENSGVSQSPLVQ
NT seq 1428 nt   +upstreamnt  +downstreamnt
atgtttgactgtatggatgttctgtcagtgagtcctgggcaaatcctggatttctacact
gcgagcccgtcttcctgcatgctccaggagaaagctctcaaagcatgcttcagtggattg
acccaaaccgaatggcaacatcggcacactgctcaatctgttaatcttcacaaacagttc
tgtgagggaagtatgattgtcctcatttttcaaaagaggaacttgaggctcagagaagcg
attgaaacacagagcaccagctctgaggaactcgtcccgagccctccgtctccacttcct
cccccccgcgtgtacaaaccctgcttcgtctgccaggacaagtcctcggggtaccactat
ggggtcagcgcctgcgagggctgtaaggggtttttccgcagaagtattcagaagaacatg
atttacacttgtcaccgagataagaactgtgttattaataaagtcaccaggaaccgatgc
cagtactgtcgactccagaagtgctttgaagtgggaatgtccaaagaatctgtcaggaat
gacagaaacaagaaaaagaaggagccttcgaagcaggaatgcacagaaagctatgaaatg
acagctgagctggatgatctcacagagaagatccgaaaagcgcaccaggaaaccttcccc
tcgctctgccagctgggtaaatacaccacgaattctagtgctgaccatcgagtccgactg
gacctgggcctctgggacaaattcagtgaactggccaccaagtgcattattaagatcgtg
gagtttgctaaacgtctgccaggcttcaccagcttgaccatcgcggaccaaatcaccctg
ctgaaggccgcctgcctggacatcctgattcttagaatttgcaccaggtacaccccagaa
caagacaccatgactttctcagatggccttaccctaaatcggactcagatgcacaatgct
ggatttggtcctctgactgaccttgtgttcacctttgccaaccagctcctgcctttggaa
atggacgacacagaaacaggccttctcagtgccatctgcttaatctgtggagaccgccag
gaccttgaagaaccaacaaaagtagataagctacaagaaccattgctggaagcactaaaa
atttatatcagaaagagacgacccagcaagcctcacatgtttccaaagatcttaatgaaa
atcacagatctccgcagcatcagcgctaaaggtgcagaacgtgtaattaccttgaaaatg
gaaattcctggatcaatgccacctctcattcaggaaatgctggagaattctgaaggacac
gaacccttgaccccaagttcaagtgggaacacagctgagcacagtcccagcatctcaccc
agctcagtggaaaacagcggtgtcagtcagtccccactggtgcaataa

DBGET integrated database retrieval system