KEGG   Desmodus rotundus (common vampire bat): 112310132
Entry
112310132         CDS       T05907                                 

Gene name
BAX
Definition
(RefSeq) apoptosis regulator BAX
  KO
K02159  apoptosis regulator BAX
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro01521  EGFR tyrosine kinase inhibitor resistance
dro01522  Endocrine resistance
dro01524  Platinum drug resistance
dro04071  Sphingolipid signaling pathway
dro04115  p53 signaling pathway
dro04141  Protein processing in endoplasmic reticulum
dro04210  Apoptosis
dro04211  Longevity regulating pathway
dro04215  Apoptosis - multiple species
dro04217  Necroptosis
dro04722  Neurotrophin signaling pathway
dro04932  Non-alcoholic fatty liver disease
dro04933  AGE-RAGE signaling pathway in diabetic complications
dro05012  Parkinson disease
dro05014  Amyotrophic lateral sclerosis
dro05016  Huntington disease
dro05020  Prion disease
dro05022  Pathways of neurodegeneration - multiple diseases
dro05132  Salmonella infection
dro05152  Tuberculosis
dro05160  Hepatitis C
dro05161  Hepatitis B
dro05162  Measles
dro05163  Human cytomegalovirus infection
dro05164  Influenza A
dro05165  Human papillomavirus infection
dro05166  Human T-cell leukemia virus 1 infection
dro05167  Kaposi sarcoma-associated herpesvirus infection
dro05168  Herpes simplex virus 1 infection
dro05169  Epstein-Barr virus infection
dro05170  Human immunodeficiency virus 1 infection
dro05200  Pathways in cancer
dro05202  Transcriptional misregulation in cancer
dro05203  Viral carcinogenesis
dro05210  Colorectal cancer
dro05212  Pancreatic cancer
dro05213  Endometrial cancer
dro05214  Glioma
dro05216  Thyroid cancer
dro05217  Basal cell carcinoma
dro05218  Melanoma
dro05220  Chronic myeloid leukemia
dro05222  Small cell lung cancer
dro05223  Non-small cell lung cancer
dro05224  Breast cancer
dro05225  Hepatocellular carcinoma
dro05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    112310132 (BAX)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    112310132 (BAX)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    112310132 (BAX)
   04215 Apoptosis - multiple species
    112310132 (BAX)
   04217 Necroptosis
    112310132 (BAX)
   04115 p53 signaling pathway
    112310132 (BAX)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    112310132 (BAX)
  09149 Aging
   04211 Longevity regulating pathway
    112310132 (BAX)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112310132 (BAX)
   05202 Transcriptional misregulation in cancer
    112310132 (BAX)
   05203 Viral carcinogenesis
    112310132 (BAX)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112310132 (BAX)
   05212 Pancreatic cancer
    112310132 (BAX)
   05225 Hepatocellular carcinoma
    112310132 (BAX)
   05226 Gastric cancer
    112310132 (BAX)
   05214 Glioma
    112310132 (BAX)
   05216 Thyroid cancer
    112310132 (BAX)
   05220 Chronic myeloid leukemia
    112310132 (BAX)
   05217 Basal cell carcinoma
    112310132 (BAX)
   05218 Melanoma
    112310132 (BAX)
   05213 Endometrial cancer
    112310132 (BAX)
   05224 Breast cancer
    112310132 (BAX)
   05222 Small cell lung cancer
    112310132 (BAX)
   05223 Non-small cell lung cancer
    112310132 (BAX)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    112310132 (BAX)
   05014 Amyotrophic lateral sclerosis
    112310132 (BAX)
   05016 Huntington disease
    112310132 (BAX)
   05020 Prion disease
    112310132 (BAX)
   05022 Pathways of neurodegeneration - multiple diseases
    112310132 (BAX)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    112310132 (BAX)
   04933 AGE-RAGE signaling pathway in diabetic complications
    112310132 (BAX)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112310132 (BAX)
   05152 Tuberculosis
    112310132 (BAX)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112310132 (BAX)
   05170 Human immunodeficiency virus 1 infection
    112310132 (BAX)
   05161 Hepatitis B
    112310132 (BAX)
   05160 Hepatitis C
    112310132 (BAX)
   05164 Influenza A
    112310132 (BAX)
   05162 Measles
    112310132 (BAX)
   05168 Herpes simplex virus 1 infection
    112310132 (BAX)
   05163 Human cytomegalovirus infection
    112310132 (BAX)
   05167 Kaposi sarcoma-associated herpesvirus infection
    112310132 (BAX)
   05169 Epstein-Barr virus infection
    112310132 (BAX)
   05165 Human papillomavirus infection
    112310132 (BAX)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    112310132 (BAX)
   01524 Platinum drug resistance
    112310132 (BAX)
   01522 Endocrine resistance
    112310132 (BAX)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:dro03029]
    112310132 (BAX)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dro02000]
    112310132 (BAX)
Mitochondrial biogenesis [BR:dro03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    112310132 (BAX)
Transporters [BR:dro02000]
 Other transporters
  Pores ion channels [TC:1]
   112310132 (BAX)
SSDB
Motif
Pfam: Bcl-2
Other DBs
NCBI-GeneID: 112310132
NCBI-ProteinID: XP_024422134
LinkDB
Position
Unknown
AA seq 193 aa
MDGSGEQPTDGGPTSSEQIMKTGALLLQGFIRDRAGRIGGDTPELALEPRVPPDASTKKL
SDCLKRIGDELDSNVELQRMIAAVDTDSPREVFFRVASEMFSDGNFNWGRVVALFYFASK
LVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAG
VLTASLTIWKKMG
NT seq 582 nt   +upstreamnt  +downstreamnt
atggacgggtccggggagcaacccacagacggggggcccaccagctctgagcagatcatg
aagacaggggcccttttacttcagggtttcatccgggatcgagcagggagaatcggggga
gacacaccggagctggccctggagcccagggtgcccccagatgcatccaccaagaagctg
agcgattgtctcaagcgcattggagatgaactggacagtaatgtggagctgcagaggatg
atcgcggctgtggacacagactccccccgcgaggtctttttccgagtggcgtccgaaatg
ttttctgacggcaacttcaactggggccgggttgtcgccctcttctactttgccagcaag
ctggtgctcaaggccctgtgcaccaaagtgcccgagctgatcaggaccatcatgggctgg
acgctggacttccttcgagagcggctgctgggctggatccaggaccagggtggttgggac
ggcctcctctcctacttcgggacacccacgtggcagacagtgaccatcttcgtggccgga
gtgctcactgcctcgctcaccatctggaagaagatgggctga

DBGET integrated database retrieval system