KEGG   Desmodus rotundus (common vampire bat): 112310397Help
Entry
112310397         CDS       T05907                                 

Gene name
ALDH2
Definition
(RefSeq) aldehyde dehydrogenase, mitochondrial
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro00010  Glycolysis / Gluconeogenesis
dro00053  Ascorbate and aldarate metabolism
dro00071  Fatty acid degradation
dro00280  Valine, leucine and isoleucine degradation
dro00310  Lysine degradation
dro00330  Arginine and proline metabolism
dro00340  Histidine metabolism
dro00380  Tryptophan metabolism
dro00410  beta-Alanine metabolism
dro00561  Glycerolipid metabolism
dro00620  Pyruvate metabolism
dro01100  Metabolic pathways
Module
dro_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:dro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    112310397 (ALDH2)
   00053 Ascorbate and aldarate metabolism
    112310397 (ALDH2)
   00620 Pyruvate metabolism
    112310397 (ALDH2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    112310397 (ALDH2)
   00561 Glycerolipid metabolism
    112310397 (ALDH2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    112310397 (ALDH2)
   00310 Lysine degradation
    112310397 (ALDH2)
   00330 Arginine and proline metabolism
    112310397 (ALDH2)
   00340 Histidine metabolism
    112310397 (ALDH2)
   00380 Tryptophan metabolism
    112310397 (ALDH2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    112310397 (ALDH2)
Enzymes [BR:dro01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     112310397 (ALDH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh HetR_C
Motif
Other DBs
NCBI-GeneID: 112310397
NCBI-ProteinID: XP_024422403
LinkDB All DBs
Position
Unknown
AA seq 520 aa AA seqDB search
MLRAAALAAGLGPRLGLRLLSTAATQVVPSPNQQPEVFYNQIFINNEWHDAVSKKTFPTV
NPSTGEVICQVAEGDKEDVDRAVKAAQAAFRLGSPWRRMDASERGRLLNRLADLIERDRT
YLAALETLDNGKPYIISYLVDLDMVLKCLRYYAGWADKYHGRTIPIDGDFFSYTRHEPVG
VCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNI
IPGFGPTAGAAIASHPDVDKVAFTGSTEVGRLIQVAAGSSNLKRVTLELGGKSPNIIMSD
ADMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDVYTEFVERSVTRAKSRVVGNPFDSQTE
QGPQVDETQFKKILGYIKSGKEEGAKLLCGGGAAADRGYFIQPTVFGDVQDGMTIAKEEI
FGPVMQILKFKTIEEVVGRANNSKYGLAAAVFTKDLDKANYLSQALQAGTVWVNCYDVFG
AQSPFGGYKMSGNGRELGEYGLQAYTEVKTVTVKVPQKNS
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgtgccgccgcactcgccgcgggcctcgggccccgcttgggcctccgcctcctg
tccactgccgccacccaggtggtgccgtcccccaaccagcagcccgaagtcttctacaac
cagatcttcataaacaatgaatggcacgacgccgtcagcaagaaaacattccccaccgtc
aatccttccactggggaagtcatctgtcaagtagccgaaggggacaaggaagatgtggac
agggcagtaaaggctgcccaggccgccttccggctgggctcgccctggcgccgcatggac
gcgtcagagaggggccggctgctgaaccgcctggccgatctgattgagcgggaccggacc
tacctggcagccttggagacgctggataatggcaagccctacatcatctcctacctggtg
gatttggacatggtcctcaaatgtctccgttattatgccggctgggctgataagtaccat
gggagaaccattccgatcgatggggacttcttcagttacacacgccatgagcctgtgggt
gtatgcgggcagatcatcccgtggaactttccactcttgatgcaagcgtggaagctgggc
ccagccttggcgaccggaaacgtggttgtgatgaaggtggctgagcagactccactcact
gccctctatgtggccaacttgataaaggaggctggctttccccctggcgtggtcaacatt
attcctggatttggccccacggctggggctgccattgcctcccacccagatgtggacaaa
gtggccttcacaggctccaccgaggttggccgcctgatccaggttgctgcagggagtagt
aacctcaagagagtgaccctggagctggggggaaagagccccaacatcatcatgtcagac
gctgacatggactgggccgtggagcaggcccactttgcgctgttcttcaaccagggccag
tgctgctgtgcaggctcccggaccttcgtgcaggaggatgtttacactgagtttgtggag
cggagcgtcacccgggccaagtctcgggtggtggggaatccctttgacagccagactgag
caggggccgcaggtggacgaaactcagtttaagaagatcctcggctacatcaagtccggg
aaggaggagggggcgaagctgctgtgtggtggaggggcggctgctgatcgtggctacttc
atccagcccactgtgtttggagatgtgcaagatggcatgaccatcgcaaaggaggagatc
tttgggccagtgatgcagatcctgaagttcaagaccatagaggaagtcgttgggagagcc
aacaattccaagtatgggctggctgcagctgtcttcacaaaggacttggacaaagccaat
tatctgtcccaagcactccaggccggcactgtgtgggtcaactgctatgatgtgtttggg
gcccagtcgccgttcgggggctacaagatgtctgggaatggccgggagctgggagagtac
ggcctgcaggcatacaccgaagtgaaaaccgtcacggtcaaagttcctcagaagaactca
taa

DBGET integrated database retrieval system