KEGG   Desmodus rotundus (common vampire bat): 112311197
Entry
112311197         CDS       T05907                                 

Gene name
MAX
Definition
(RefSeq) protein max isoform X1
  KO
K04453  Max protein
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04010  MAPK signaling pathway
dro05200  Pathways in cancer
dro05202  Transcriptional misregulation in cancer
dro05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112311197 (MAX)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112311197 (MAX)
   05202 Transcriptional misregulation in cancer
    112311197 (MAX)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    112311197 (MAX)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dro03000]
    112311197 (MAX)
Transcription factors [BR:dro03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Mad/Max
    112311197 (MAX)
SSDB
Motif
Pfam: HLH DUF5716 Filament SlyX Jnk-SapK_ap_N bZIP_2 DUF5595 ZapB DUF4763 Csm1_N ATG16 V_ATPase_I
Other DBs
NCBI-GeneID: 112311197
NCBI-ProteinID: XP_024423232
LinkDB
Position
Unknown
AA seq 160 aa
MSDNDDIEVESDEEQPRFQSAADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKASR
AQILDKATEYIQYMRRKNHTHQQDIDDLKRQNALLEQQVRALEKARSSAQLQTNYPSSDN
SLYTNAKGSTISAFDGGSDSSSESEPEEPQSRKKLRMEAS
NT seq 483 nt   +upstreamnt  +downstreamnt
atgagcgataacgatgacatcgaggtggagagcgacgaagagcaaccgaggtttcaatct
gcggctgacaaacgggctcatcataatgcactggaacgaaaacgtagggaccacatcaaa
gacagctttcacagtttgcgggactcagtcccatcactccaaggagagaaggcatctcgg
gcccaaatcctagacaaagccacagagtatatccagtatatgcgaaggaaaaaccacaca
caccagcaagatattgatgacctcaagcggcagaatgctcttctggagcagcaagtccgt
gcactggagaaggcgaggtcgagtgcccaactgcagaccaactacccctcctcagacaac
agcctctacaccaacgccaagggcagcaccatctctgccttcgatgggggctcggactcc
agctcagagtcggagcccgaagagccccaaagcaggaagaaactccggatggaggccagc
taa

DBGET integrated database retrieval system