KEGG   Desmodus rotundus (common vampire bat): 112311212
Entry
112311212         CDS       T05907                                 

Gene name
PTGDR
Definition
(RefSeq) prostaglandin D2 receptor
  KO
K04332  prostaglandin D2 receptor
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    112311212 (PTGDR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:dro04030]
    112311212 (PTGDR)
G protein-coupled receptors [BR:dro04030]
 Rhodopsin family
  Lipid
   Prostaglandin
    112311212 (PTGDR)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srx HemY_N DUF2892 ResB PhoR
Other DBs
NCBI-GeneID: 112311212
NCBI-ProteinID: XP_024423263
LinkDB
Position
Unknown
AA seq 363 aa
MKPTFYRCQNTTSVEKGYSATMGWVLFSAGLLGNLLALGLLARSGLGSCPLRSPRQAPSV
FYVLVCGLTITDLLGKCLLSPVVLAAYAQNRSLWGLVSTPGSSLCHAFAFSMSFFGLAST
LQLLAMALECWLSLGHPFFYREYITLRRGALVAPVVSTFSLAFCALPFAGFGKFVQYCPG
TWCFIQMAHEERSPSVLGYSVLYASILALLVLAIVLCNLSAMRNLYAMHRRLRQRQRQRS
VARDRAELSAGEREAPPPPLEELDHLVLLALMTVLFTMCSLPLTYRAYHGAFKAVPKENG
ASEEAEDLRALRFISVISIVDPWIFIIFRTSVFRMFFHKIFIRPLMYRNWHSNSCRTNME
SSL
NT seq 1092 nt   +upstreamnt  +downstreamnt
atgaagccgacgttctaccgctgccaaaacaccacctcggtggagaaaggttactcggcg
accatgggctgggtgctcttcagcgcgggcctcctgggcaacctgctggctctggggctg
ctggcgcgctcggggctggggtcgtgcccactgcgctcgccgcgccaggcgccttcggtc
ttctacgtgctcgtgtgcggcctgaccatcaccgacttgctgggcaagtgcctcttgagc
cccgtcgtgctggcagcctacgcgcagaaccggagcctgtgggggctggtgtccacgccg
ggcagctctctgtgccatgccttcgcctttagtatgtctttcttcggcctcgcctcgacg
ctgcagctcctggccatggccctggaatgctggctctccctgggacaccccttcttctac
cgagagtacatcaccctccgccggggcgcgctggtggcgcccgtcgtgagcaccttctcc
ttggctttctgcgcgctgcccttcgcaggcttcgggaagttcgtgcagtactgccccggc
acgtggtgcttcatccagatggcccacgaggagcgctcgccgtcggtgctgggctactca
gtgctctacgccagcatcctggcgctgctggtcctcgccattgtgctgtgcaacctgagc
gccatgcgcaacctctacgcgatgcaccggcggctgcggcagcgccagcgccagcgctcg
gtggccagggaccgcgcggaactcagcgccggtgaacgggaggcgcccccgccacctctg
gaggagctggatcacctcgtgctgctggccctcatgaccgtgctcttcaccatgtgctcc
ctgcctttaacttatcgtgcttaccatggagcatttaaagctgtgcccaaggaaaatgga
gcctctgaagaagctgaagacctccgcgccttgcgttttatatctgtgatctcaattgtg
gacccttggattttcatcattttcagaacatcagtatttcggatgttttttcacaagatt
ttcatcaggcctcttatgtatagaaattggcatagcaattcctgccgaactaacatggaa
tccagtctgtga

DBGET integrated database retrieval system