KEGG   Desmodus rotundus (common vampire bat): 112311221
Entry
112311221         CDS       T05907                                 

Gene name
TGFB3
Definition
(RefSeq) transforming growth factor beta-3
  KO
K13377  transforming growth factor beta-3
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04010  MAPK signaling pathway
dro04060  Cytokine-cytokine receptor interaction
dro04068  FoxO signaling pathway
dro04110  Cell cycle
dro04218  Cellular senescence
dro04350  TGF-beta signaling pathway
dro04390  Hippo signaling pathway
dro04933  AGE-RAGE signaling pathway in diabetic complications
dro05140  Leishmaniasis
dro05142  Chagas disease
dro05144  Malaria
dro05145  Toxoplasmosis
dro05146  Amoebiasis
dro05152  Tuberculosis
dro05161  Hepatitis B
dro05166  Human T-cell leukemia virus 1 infection
dro05200  Pathways in cancer
dro05210  Colorectal cancer
dro05211  Renal cell carcinoma
dro05212  Pancreatic cancer
dro05220  Chronic myeloid leukemia
dro05225  Hepatocellular carcinoma
dro05226  Gastric cancer
dro05321  Inflammatory bowel disease
dro05323  Rheumatoid arthritis
dro05410  Hypertrophic cardiomyopathy
dro05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112311221 (TGFB3)
   04350 TGF-beta signaling pathway
    112311221 (TGFB3)
   04390 Hippo signaling pathway
    112311221 (TGFB3)
   04068 FoxO signaling pathway
    112311221 (TGFB3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    112311221 (TGFB3)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112311221 (TGFB3)
   04218 Cellular senescence
    112311221 (TGFB3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112311221 (TGFB3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112311221 (TGFB3)
   05212 Pancreatic cancer
    112311221 (TGFB3)
   05225 Hepatocellular carcinoma
    112311221 (TGFB3)
   05226 Gastric cancer
    112311221 (TGFB3)
   05220 Chronic myeloid leukemia
    112311221 (TGFB3)
   05211 Renal cell carcinoma
    112311221 (TGFB3)
  09163 Immune disease
   05323 Rheumatoid arthritis
    112311221 (TGFB3)
   05321 Inflammatory bowel disease
    112311221 (TGFB3)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    112311221 (TGFB3)
   05414 Dilated cardiomyopathy
    112311221 (TGFB3)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    112311221 (TGFB3)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    112311221 (TGFB3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112311221 (TGFB3)
   05161 Hepatitis B
    112311221 (TGFB3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    112311221 (TGFB3)
   05144 Malaria
    112311221 (TGFB3)
   05145 Toxoplasmosis
    112311221 (TGFB3)
   05140 Leishmaniasis
    112311221 (TGFB3)
   05142 Chagas disease
    112311221 (TGFB3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:dro04052]
    112311221 (TGFB3)
Cytokines and growth factors [BR:dro04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   112311221 (TGFB3)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 112311221
NCBI-ProteinID: XP_024423279
LinkDB
Position
Unknown
AA seq 408 aa
MKMHLQRALVVLALLNFATVSVSLSTCTTLDFSHIKKKRVEAIRGQILSKLRLTSPPEPS
VMTHVPYQILALYNSTRELLEEREDGCTQENTEWEYYAKEIHKFDMIQGLAEHNELAVCP
KGITSKVFRFNVSSVEKNGTNLFRAEFRVLRVPNPSSKRNEQRIELFQILRPDEHIAKQR
YIGGKNLPTRGTAEWLSFDVTETVREWLSRRESNLGLEISIHCPCHTFQPNGDILENIHE
VMEIKFKGVDSEDDHGRGDLGRLRKQKDHHNPHLILMMIPPHRLDNGGQGGQRKKRALDT
NYCFSNVEENCCVRPLYIDFRQDLGWKWVHEPKGYYANFCSGPCPYLRSADTTHSKVLGL
YNTLNPEASASPCCVPQDLEPLTILYYVGRTPKVEHLSNMVVKSCKCS
NT seq 1227 nt   +upstreamnt  +downstreamnt
atgaagatgcacttgcaaagggctctggtggtcctggccctgctgaactttgccacagtc
agcgtctctctgtccacttgcaccaccttggacttcagccacatcaagaagaagagggtg
gaagccattaggggacagatcttgagcaaactcaggctcactagtccccctgagccatcg
gtgatgacccatgtcccctaccagatcctggccctttacaacagcacccgggagctgctg
gaggagagggaggatggctgcactcaggaaaacaccgagtgggagtactatgccaaagaa
atccataaattcgacatgatccaggggctggcggaacacaacgagctagccgtctgcccc
aaaggaatcacctccaaggttttccgcttcaacgtgtcctccgtggagaaaaatggcacc
aacctattccgagcagaattccgggtcttgcgggtgccgaaccccagctccaagcgcaat
gagcagaggatcgagctcttccagatactccggccagatgaacacatcgccaagcaacgt
tatattggtggcaagaatctgcccacacggggcaccgccgagtggctgtcttttgatgtc
actgaaactgtgcgtgaatggctctcgcgaagagagtccaacttaggtctggaaatcagt
attcattgtccctgtcacacctttcagcccaatggagacatcctggaaaacattcacgag
gtgatggaaatcaaattcaaaggtgtggacagcgaggatgaccatggccgtggggatctg
ggacgcctcaggaagcagaaggaccaccacaaccctcatctaatcctcatgatgatcccc
ccacaccggctggacaacgggggccagggtgggcagaggaagaagcgggccctggacacc
aattactgctttagcaatgtggaagagaactgctgtgtgcgccctctctacatcgacttc
cgccaggatctgggctggaaatgggtccacgaacctaagggctactacgccaacttctgc
tcaggcccctgcccatacctccgcagtgcagacacaacccacagcaaggtgctgggcctg
tataacactttgaaccctgaagcgtctgcctctccgtgctgcgtgccccaggacttggag
cccttgaccatcctgtactacgttgggaggacccccaaggtggaacatctctctaacatg
gtggtgaagtcctgtaagtgtagctga

KEGG   Desmodus rotundus (common vampire bat): 112318906
Entry
112318906         CDS       T05907                                 

Gene name
TGFB2
Definition
(RefSeq) transforming growth factor beta-2 isoform X1
  KO
K13376  transforming growth factor beta-2
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04010  MAPK signaling pathway
dro04060  Cytokine-cytokine receptor interaction
dro04068  FoxO signaling pathway
dro04110  Cell cycle
dro04218  Cellular senescence
dro04350  TGF-beta signaling pathway
dro04380  Osteoclast differentiation
dro04390  Hippo signaling pathway
dro04933  AGE-RAGE signaling pathway in diabetic complications
dro05140  Leishmaniasis
dro05142  Chagas disease
dro05144  Malaria
dro05145  Toxoplasmosis
dro05146  Amoebiasis
dro05152  Tuberculosis
dro05161  Hepatitis B
dro05166  Human T-cell leukemia virus 1 infection
dro05200  Pathways in cancer
dro05205  Proteoglycans in cancer
dro05206  MicroRNAs in cancer
dro05210  Colorectal cancer
dro05211  Renal cell carcinoma
dro05212  Pancreatic cancer
dro05220  Chronic myeloid leukemia
dro05225  Hepatocellular carcinoma
dro05226  Gastric cancer
dro05321  Inflammatory bowel disease
dro05323  Rheumatoid arthritis
dro05410  Hypertrophic cardiomyopathy
dro05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112318906 (TGFB2)
   04350 TGF-beta signaling pathway
    112318906 (TGFB2)
   04390 Hippo signaling pathway
    112318906 (TGFB2)
   04068 FoxO signaling pathway
    112318906 (TGFB2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    112318906 (TGFB2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112318906 (TGFB2)
   04218 Cellular senescence
    112318906 (TGFB2)
 09150 Organismal Systems
  09158 Development and regeneration
   04380 Osteoclast differentiation
    112318906 (TGFB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112318906 (TGFB2)
   05206 MicroRNAs in cancer
    112318906 (TGFB2)
   05205 Proteoglycans in cancer
    112318906 (TGFB2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112318906 (TGFB2)
   05212 Pancreatic cancer
    112318906 (TGFB2)
   05225 Hepatocellular carcinoma
    112318906 (TGFB2)
   05226 Gastric cancer
    112318906 (TGFB2)
   05220 Chronic myeloid leukemia
    112318906 (TGFB2)
   05211 Renal cell carcinoma
    112318906 (TGFB2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    112318906 (TGFB2)
   05321 Inflammatory bowel disease
    112318906 (TGFB2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    112318906 (TGFB2)
   05414 Dilated cardiomyopathy
    112318906 (TGFB2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    112318906 (TGFB2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    112318906 (TGFB2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112318906 (TGFB2)
   05161 Hepatitis B
    112318906 (TGFB2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    112318906 (TGFB2)
   05144 Malaria
    112318906 (TGFB2)
   05145 Toxoplasmosis
    112318906 (TGFB2)
   05140 Leishmaniasis
    112318906 (TGFB2)
   05142 Chagas disease
    112318906 (TGFB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:dro04052]
    112318906 (TGFB2)
   00536 Glycosaminoglycan binding proteins [BR:dro00536]
    112318906 (TGFB2)
Cytokines and growth factors [BR:dro04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   112318906 (TGFB2)
Glycosaminoglycan binding proteins [BR:dro00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   112318906 (TGFB2)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta SPEG_u2
Other DBs
NCBI-GeneID: 112318906
NCBI-ProteinID: XP_024431912
LinkDB
Position
Unknown
AA seq 442 aa
MHYCVLSALGLLHLVTAALSLSTCSTLDMEQFMRKRIEAIRGQILSKLKLTSPPEEYPEP
EDVPPEVISIYNSTRDLLQEKASRRAAACERERSDEEYYAKEVYKIDRTPYLSSETVCPV
VTTPSGSVGSLCSRQSQVLCGYLDAIPPTFYRPYSRIVRFDVSAMEKNASNLVKAEFRVF
RLQNPKARVPEQRIELYQILKAKDVTSPNQRYIDSKVVKTRAEGEWLSFDVTDAVHEWLH
HKDRNLGFKISLHCPCCTFVASNNYIIPNKSEELEARFAGIDGTSTYTSGDQKTIKSTRK
KNSGKTPHLLLMLLPSYRLESQQSNRRKKRALDAAYCFRNVQDNCCLRPLYIDFKRDLGW
KWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILY
YIGKTPKIEQLSNMIVKSCKCS
NT seq 1329 nt   +upstreamnt  +downstreamnt
atgcactactgtgtgctgagcgctttggggcttctgcatctggtcacggccgcgctcagc
ctgtctacctgcagcacgctggacatggaacagttcatgcgcaagaggatcgaggcgatc
cgcgggcagatcctgagcaagctgaagctcaccagccccccagaagagtaccccgagccc
gaggacgtccccccggaggtgatctccatctacaacagcaccagggacttgctccaggag
aaggcgagccggagagctgccgcctgcgagcgcgagcgcagcgacgaggagtattacgcg
aaggaggtttacaagatagaccggacgccctacttatcctcggaaactgtctgcccagtt
gttacaacaccctctggctcagtgggcagcttgtgctccagacagtcccaggtgctctgt
gggtaccttgatgctatcccgcccacgttctacagaccctactccagaatcgtccggttc
gacgtctccgcgatggagaagaatgcttccaacttggtgaaggccgagttcagagtgttt
cgtttacagaacccaaaagccagggttcctgagcagcggatcgaactgtaccagattctc
aaagccaaggatgtaacgtcaccaaaccagcgctacatcgacagcaaagtcgtgaaaaca
agagccgaaggagaatggctttcctttgatgtgactgatgctgtgcacgagtggctccac
cataaagacaggaacctgggatttaaaataagtttacactgtccctgctgcacctttgta
gcatctaacaattacatcatccccaataaaagcgaagaactagaagcaagatttgcaggt
attgatggcacctccacatataccagtggtgatcagaaaactataaagtccactaggaaa
aaaaacagtgggaagaccccacacctcctgctaatgttgttaccctcctacagacttgag
tcacaacagtccaaccggcggaagaagcgcgccttggatgcagcctattgctttagaaat
gtgcaggataattgctgcctgcgtccactttacattgatttcaagagggatcttgggtgg
aaatggatccacgaacctaaagggtacaatgccaacttctgtgctggggcatgcccgtat
ttatggagttcagacactcagcacagtagggttctcagcttatataatacaataaatccg
gaagcgtctgcttctccttgctgtgtgtcccaggatttggaaccgctaaccattctctac
tacatcggcaaaacacccaagatcgaacagctctctaatatgatcgtgaagtcgtgcaaa
tgcagctaa

KEGG   Desmodus rotundus (common vampire bat): 112320009
Entry
112320009         CDS       T05907                                 

Gene name
TGFB1
Definition
(RefSeq) transforming growth factor beta-1
  KO
K13375  transforming growth factor beta-1
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04010  MAPK signaling pathway
dro04060  Cytokine-cytokine receptor interaction
dro04068  FoxO signaling pathway
dro04110  Cell cycle
dro04218  Cellular senescence
dro04350  TGF-beta signaling pathway
dro04380  Osteoclast differentiation
dro04390  Hippo signaling pathway
dro04659  Th17 cell differentiation
dro04672  Intestinal immune network for IgA production
dro04926  Relaxin signaling pathway
dro04932  Non-alcoholic fatty liver disease
dro04933  AGE-RAGE signaling pathway in diabetic complications
dro05140  Leishmaniasis
dro05142  Chagas disease
dro05144  Malaria
dro05145  Toxoplasmosis
dro05146  Amoebiasis
dro05152  Tuberculosis
dro05161  Hepatitis B
dro05166  Human T-cell leukemia virus 1 infection
dro05200  Pathways in cancer
dro05205  Proteoglycans in cancer
dro05210  Colorectal cancer
dro05211  Renal cell carcinoma
dro05212  Pancreatic cancer
dro05220  Chronic myeloid leukemia
dro05225  Hepatocellular carcinoma
dro05226  Gastric cancer
dro05321  Inflammatory bowel disease
dro05323  Rheumatoid arthritis
dro05410  Hypertrophic cardiomyopathy
dro05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112320009 (TGFB1)
   04350 TGF-beta signaling pathway
    112320009 (TGFB1)
   04390 Hippo signaling pathway
    112320009 (TGFB1)
   04068 FoxO signaling pathway
    112320009 (TGFB1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    112320009 (TGFB1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112320009 (TGFB1)
   04218 Cellular senescence
    112320009 (TGFB1)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    112320009 (TGFB1)
   04672 Intestinal immune network for IgA production
    112320009 (TGFB1)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    112320009 (TGFB1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    112320009 (TGFB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112320009 (TGFB1)
   05205 Proteoglycans in cancer
    112320009 (TGFB1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112320009 (TGFB1)
   05212 Pancreatic cancer
    112320009 (TGFB1)
   05225 Hepatocellular carcinoma
    112320009 (TGFB1)
   05226 Gastric cancer
    112320009 (TGFB1)
   05220 Chronic myeloid leukemia
    112320009 (TGFB1)
   05211 Renal cell carcinoma
    112320009 (TGFB1)
  09163 Immune disease
   05323 Rheumatoid arthritis
    112320009 (TGFB1)
   05321 Inflammatory bowel disease
    112320009 (TGFB1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    112320009 (TGFB1)
   05414 Dilated cardiomyopathy
    112320009 (TGFB1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    112320009 (TGFB1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    112320009 (TGFB1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    112320009 (TGFB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112320009 (TGFB1)
   05161 Hepatitis B
    112320009 (TGFB1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    112320009 (TGFB1)
   05144 Malaria
    112320009 (TGFB1)
   05145 Toxoplasmosis
    112320009 (TGFB1)
   05140 Leishmaniasis
    112320009 (TGFB1)
   05142 Chagas disease
    112320009 (TGFB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:dro03110]
    112320009 (TGFB1)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:dro04052]
    112320009 (TGFB1)
   00536 Glycosaminoglycan binding proteins [BR:dro00536]
    112320009 (TGFB1)
Chaperones and folding catalysts [BR:dro03110]
 Intramolecular chaperones
  Others
   112320009 (TGFB1)
Cytokines and growth factors [BR:dro04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   112320009 (TGFB1)
Glycosaminoglycan binding proteins [BR:dro00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   112320009 (TGFB1)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 112320009
NCBI-ProteinID: XP_024433172
LinkDB
Position
Unknown
AA seq 381 aa
MPPSGLRLLPLLLPLLWLLVLAPGRPAAGLSTCKTIDMELVKRKRIEAIRGQILSKLRLA
SPPSQAEVPPGPLPEAVLALYNSTRDRVAGESAEPEPEPETDYYAKEVTRVLTVENSHEI
YETFKHNSHSIYMFFNTSELREAVPEPQLLSRAELRLQRHKLKVEQHVELYQKYSNNSWR
YLSNQLLAPSDTPEWLSFEVTGVVRQWLSHRGEIEGFRLSAHCSCDSKDDTLHVEINGIS
VGRRGDLATIHGINRPFLLLMATPLERAQHLHSPRHRRALDTSYCFSSTEKNCCVRQLYI
DFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQA
LEPLPIVYYVGRKPKVEQLSN
NT seq 1143 nt   +upstreamnt  +downstreamnt
atgccgccctccgggctgcggctgttgccgctgctgctgcctctgctgtggctactagtg
ctagcgcctggccggccggccgccggactgtccacctgcaagaccatcgacatggagctg
gtgaagcggaagcgcatcgaggccatccgcggccagatcctgtccaaactacggctggcc
agccccccaagccaggcggaggtgccgcctggtccgctgccggaggccgtgctggccctt
tacaacagtacccgcgaccgggtggctggggagagcgccgagccggagcccgagccggag
acggactactacgccaaggaggtcacccgtgtgctaacggtggaaaacagccacgaaatc
tatgagacattcaagcataactcacacagcatatatatgttcttcaacacatcggagctc
cgggaagcagtgcctgaaccccagttgctctcccgggcagagctgcgcctgcagaggcac
aagttgaaagtggagcagcacgtggagctgtaccagaaatacagcaacaattcctggcgc
tacctcagcaaccagctgctggcccccagcgacacgcctgagtggctgtcctttgaggtc
actggagtcgtgcggcagtggctgagccacagaggcgaaatcgagggctttcgcctcagt
gcccactgctcttgtgacagcaaagatgatacactccacgtggaaatcaacggaatcagt
gttggccgccggggcgacctggccaccattcatggcataaaccggcccttcctgcttctc
atggccaccccactggagagagcccagcacctgcacagcccccggcaccgccgagccctg
gacaccagctactgcttcagctccacggagaaaaactgctgcgtgcggcagctctacatt
gactttcgcaaggatctgggctggaaatggatccacgagcccaagggctaccacgccaac
ttctgcctggggccctgcccctacatttggagcctggacacgcagtacagcaaggtcctg
gccctgtacaaccagcacaacccgggcgcgtcggcggcgccgtgctgcgtgccgcaggcg
ctggagcccctgcccatcgtgtactacgtgggccgcaagcccaaggtggagcaactgtcc
aat

DBGET integrated database retrieval system