KEGG   Desmodus rotundus (common vampire bat): 112311852
Entry
112311852         CDS       T05907                                 

Gene name
CCNA1
Definition
(RefSeq) cyclin-A1
  KO
K06627  cyclin-A
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04110  Cell cycle
dro04152  AMPK signaling pathway
dro04218  Cellular senescence
dro04914  Progesterone-mediated oocyte maturation
dro05161  Hepatitis B
dro05165  Human papillomavirus infection
dro05166  Human T-cell leukemia virus 1 infection
dro05169  Epstein-Barr virus infection
dro05200  Pathways in cancer
dro05202  Transcriptional misregulation in cancer
dro05203  Viral carcinogenesis
dro05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    112311852 (CCNA1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112311852 (CCNA1)
   04218 Cellular senescence
    112311852 (CCNA1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    112311852 (CCNA1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112311852 (CCNA1)
   05202 Transcriptional misregulation in cancer
    112311852 (CCNA1)
   05203 Viral carcinogenesis
    112311852 (CCNA1)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    112311852 (CCNA1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112311852 (CCNA1)
   05161 Hepatitis B
    112311852 (CCNA1)
   05169 Epstein-Barr virus infection
    112311852 (CCNA1)
   05165 Human papillomavirus infection
    112311852 (CCNA1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:dro03032]
    112311852 (CCNA1)
   03036 Chromosome and associated proteins [BR:dro03036]
    112311852 (CCNA1)
DNA replication proteins [BR:dro03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    112311852 (CCNA1)
Chromosome and associated proteins [BR:dro03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    112311852 (CCNA1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C Cyclin_N2
Other DBs
NCBI-GeneID: 112311852
NCBI-ProteinID: XP_024424093
LinkDB
Position
Unknown
AA seq 418 aa
MHLSSKSGVVLAPASRGPDACQMATRAQLGQDPPQRTVLGVLTENVQYRSGQGIPTVRYF
SGSENAFPAVGPKALSACGAHVPAKQGFDVHMAEAEPEDGPSCAGSDGVAFGDAYEVDTS
TLKSDLHFLLDFSAVSPMVVDAALHSQSEAASDLGTDVISVTEYAEEIHQYLREAEVRRR
PKAHYLRKQPDITDGMRRILVDWLVEVAEEYQLRAETLYLAVNFLDRFLSCMSVLRGKLQ
LVGTAAILLASKYEEIYPPEVDEFVYITDDTYTKRQLLRMEHLLLKVLAFDLTVPTTHQF
LLQYLRRQGVCVRTENLAKYVAELSLLEADPFLKYLPSLIAAAAYCLANYTVNKHFWPET
LAAFTGYSLSEIGPCLCELHRACLDVPHRPQQAIREKYKASKYLHVSLMEPPAVLPLQ
NT seq 1257 nt   +upstreamnt  +downstreamnt
atgcatcttagctccaagagcggagtagtcctggctccggcgtcccgaggtcccgatgcc
tgtcagatggcgaccagagcccagctcggccaggaccccccacaaagaacagtgctaggg
gtgctaaccgagaatgtgcagtaccggagcggccaggggatccccacggtaaggtacttc
tcggggtcggaaaatgccttccctgcagtcgggccgaaagcactctctgcctgcggggcc
cacgtgccggccaagcagggattcgacgtccacatggccgaggctgagccggaggatgga
cccagctgtgcagggagcgatggggtggcctttggggacgcatacgaagtggacaccagc
acactgaagtcagacctgcacttcctgctggactttagcgcagtgtcccctatggtggta
gatgcagccctccattcccagtctgaagcggcgtccgatttgggcacagatgtgatcagc
gtgacggaatatgctgaagaaattcatcagtacctccgagaagctgaagtgcgacgccgg
cccaaggcgcactacctgcggaagcagcccgacatcacggacggcatgcgccggatcctg
gtggactggctggtggaggtggccgaggagtaccagctgcgagccgagaccctctacctg
gccgtcaacttcctggaccgcttcctttcctgcatgtccgtcctgagaggcaaactgcag
ctcgtggggacagcggccattctcctggcctcgaagtacgaagagatctacccgcccgag
gtggacgagtttgtctacataacggacgacacctacacaaagcggcagctgctgagaatg
gagcacctgctcctgaaggtgctggccttcgacctgaccgtgcccaccacccaccagttc
ctcctgcagtacctgaggaggcagggggtgtgcgtcaggaccgagaacctggccaagtac
gtcgcagaactgagtctactcgaagccgacccattcctgaaatacctcccttccctgata
gcggcggctgcgtactgcctggccaactacaccgtcaacaagcacttctggccagagacc
ctggctgcgttcacgggctactcgttaagcgaaatcgggccgtgcctgtgtgagctccac
agagcctgcctggacgtgccgcaccgacctcagcaggccatccgggagaagtacaaggcc
tcgaagtacctgcacgtgtccctcatggagccgcctgctgtgctccctctgcagtga

KEGG   Desmodus rotundus (common vampire bat): 112312522
Entry
112312522         CDS       T05907                                 

Gene name
CCNA2
Definition
(RefSeq) cyclin-A2
  KO
K06627  cyclin-A
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04110  Cell cycle
dro04152  AMPK signaling pathway
dro04218  Cellular senescence
dro04914  Progesterone-mediated oocyte maturation
dro05161  Hepatitis B
dro05165  Human papillomavirus infection
dro05166  Human T-cell leukemia virus 1 infection
dro05169  Epstein-Barr virus infection
dro05200  Pathways in cancer
dro05202  Transcriptional misregulation in cancer
dro05203  Viral carcinogenesis
dro05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    112312522 (CCNA2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112312522 (CCNA2)
   04218 Cellular senescence
    112312522 (CCNA2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    112312522 (CCNA2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112312522 (CCNA2)
   05202 Transcriptional misregulation in cancer
    112312522 (CCNA2)
   05203 Viral carcinogenesis
    112312522 (CCNA2)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    112312522 (CCNA2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112312522 (CCNA2)
   05161 Hepatitis B
    112312522 (CCNA2)
   05169 Epstein-Barr virus infection
    112312522 (CCNA2)
   05165 Human papillomavirus infection
    112312522 (CCNA2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:dro03032]
    112312522 (CCNA2)
   03036 Chromosome and associated proteins [BR:dro03036]
    112312522 (CCNA2)
DNA replication proteins [BR:dro03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    112312522 (CCNA2)
Chromosome and associated proteins [BR:dro03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    112312522 (CCNA2)
SSDB
Motif
Pfam: Cyclin_N2 Cyclin_N Cyclin_C FGE-sulfatase
Other DBs
NCBI-GeneID: 112312522
NCBI-ProteinID: XP_024424800
LinkDB
Position
Unknown
AA seq 428 aa
MLGSSAAREAGSALLTVQQTAPQEDQENINPEKASPAQQPRTRAGLAVLKAGNQRGPAPP
QRPKTRRVAPLKDLNVNDEHVIVPPWNANSKQPAFTIHVDEAEKETQKRPGESKKTECED
VLAFNSAIALPEPRKPLVPLDYPMDGSFESPQTMDMSIILEDEKPVNVNEVPDYHEDIHT
YLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLS
SMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLAF
DLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAFHLAL
YTVTGQSWPDSLVQQTGYTLESLKPCLLDLHQTYLRAPQHAQQSVREKYKHPKYHGVSLL
APPETLQV
NT seq 1287 nt   +upstreamnt  +downstreamnt
atgttgggcagctctgcggcccgcgaggcgggctcggcgctgctcaccgtgcagcagaca
gcaccccaagaggaccaggagaacatcaaccccgagaaggcgtcgcccgcccagcagccc
cggacccgggcggggctggcggtgctgaaggccgggaaccagcggggtccagcgccgccg
caaaggcccaagacgcgacgggttgcaccccttaaggatcttaatgtaaatgatgagcat
gtcattgttcctccctggaatgcgaacagtaaacagcctgcatttaccatccatgtggat
gaagcagaaaaagagactcaaaagaggccaggtgaatccaaaaaaacagaatgtgaagat
gtcctggcatttaattcagccattgctttacctgaaccgagaaaaccgctggtacctctt
gattatccgatggatggaagttttgagtcaccacagacaatggacatgtcaatcatattg
gaagatgagaagccagtaaacgttaacgaagtcccagactaccacgaggacattcacacc
tacctgagggaaatggaggttaaatgtaagcctaaagtgggttacatgaagaaacagcca
gacatcaccaacagtatgagggctatcctcgtggactggttagttgaagtaggagaagaa
tataaactacagaatgagactctgcacttggccgtgaactacatcgataggttcctttca
tccatgtctgtgttgagaggaaaacttcagcttgtgggcactgctgctatgctgttagcc
tcgaagtttgaagaaatttaccccccagaagtagcagagtttgtgtacattacagacgac
acctacaccaagaagcaggttctcagaatggagcacctggtcctcaaagtcctcgctttc
gacttggccgccccaaccgtcaatcagttcctcacccagtactttctgcaccagcagcct
gcaaactgcaaagttgaaagcttagcaatgtttctgggagagctgagtctgatcgacgcg
gacccgtacctcaagtacctgccctcagttatcgccggagcggccttccacctagcactc
tacacagtcacgggacagagctggcccgactccttggtgcagcagacaggatacaccctg
gagagcctgaagccctgtctcctggacctgcaccagacctacctcagggccccgcagcat
gcccagcagtcggtcagagagaagtacaagcaccccaagtaccacggtgtttccctcctc
gccccaccagagacactacaggtgtga

DBGET integrated database retrieval system