KEGG   Desmodus rotundus (common vampire bat): 112312503
Entry
112312503         CDS       T05907                                 

Gene name
IL2
Definition
(RefSeq) interleukin-2
  KO
K05429  interleukin 2
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04060  Cytokine-cytokine receptor interaction
dro04061  Viral protein interaction with cytokine and cytokine receptor
dro04151  PI3K-Akt signaling pathway
dro04625  C-type lectin receptor signaling pathway
dro04630  JAK-STAT signaling pathway
dro04658  Th1 and Th2 cell differentiation
dro04659  Th17 cell differentiation
dro04660  T cell receptor signaling pathway
dro04672  Intestinal immune network for IgA production
dro04940  Type I diabetes mellitus
dro05135  Yersinia infection
dro05142  Chagas disease
dro05162  Measles
dro05166  Human T-cell leukemia virus 1 infection
dro05200  Pathways in cancer
dro05320  Autoimmune thyroid disease
dro05321  Inflammatory bowel disease
dro05330  Allograft rejection
dro05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    112312503 (IL2)
   04151 PI3K-Akt signaling pathway
    112312503 (IL2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    112312503 (IL2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    112312503 (IL2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    112312503 (IL2)
   04660 T cell receptor signaling pathway
    112312503 (IL2)
   04658 Th1 and Th2 cell differentiation
    112312503 (IL2)
   04659 Th17 cell differentiation
    112312503 (IL2)
   04672 Intestinal immune network for IgA production
    112312503 (IL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112312503 (IL2)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    112312503 (IL2)
   05321 Inflammatory bowel disease
    112312503 (IL2)
   05330 Allograft rejection
    112312503 (IL2)
   05332 Graft-versus-host disease
    112312503 (IL2)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    112312503 (IL2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    112312503 (IL2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112312503 (IL2)
   05162 Measles
    112312503 (IL2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    112312503 (IL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:dro04052]
    112312503 (IL2)
   00536 Glycosaminoglycan binding proteins [BR:dro00536]
    112312503 (IL2)
Cytokines and growth factors [BR:dro04052]
 Cytokines
  Interleukins
   112312503 (IL2)
Glycosaminoglycan binding proteins [BR:dro00536]
 Heparan sulfate / Haparin
  Cytokines
   112312503 (IL2)
SSDB
Motif
Pfam: IL2 Baculo_PEP_C T6SS_VipA
Other DBs
NCBI-GeneID: 112312503
NCBI-ProteinID: XP_024424779
LinkDB
Position
Unknown
AA seq 154 aa
MYKLHFLSCVALTLAFIADGAPTSGSSKDTRQKLVDIKEDLEKLLKGVNNYKNHEHSTML
TFKFYTPRKVTELKHLLCLRDELNPLKDVLNLTQRKSFHLAEMVRSVENINVTVNALVDP
MEGLPCEYDDETATFVEFLTKWAAFCQSIFSTLT
NT seq 465 nt   +upstreamnt  +downstreamnt
atgtacaagctgcacttcttgtcctgtgttgcactaactctcgcattcattgcagacggt
gcacctacctcgggctccagcaaggacacccgacagaagctggtggacataaaggaggac
ttggagaagctgctgaaaggggtcaataattacaagaaccacgaacactccacgatgctc
acgtttaagttttacacacccaggaaggtcacagaattgaaacatctgctgtgtctaagg
gacgaactcaaccctctgaaggacgtgctaaatttaactcaaagaaaaagctttcacctg
gcagagatggtgcgatcagtggaaaacatcaacgtaacagtgaacgcactagtggacccc
atggagggactcccgtgcgagtatgatgacgagacggcgaccttcgtagagttcctgacc
aagtgggctgccttctgccagagcatcttctcgacgctgacctaa

DBGET integrated database retrieval system