KEGG   Desmodus rotundus (common vampire bat): 112313044
Entry
112313044         CDS       T05907                                 

Gene name
RB1
Definition
(RefSeq) retinoblastoma-associated protein
  KO
K06618  retinoblastoma-associated protein
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro01522  Endocrine resistance
dro04110  Cell cycle
dro04218  Cellular senescence
dro04934  Cushing syndrome
dro05160  Hepatitis C
dro05161  Hepatitis B
dro05163  Human cytomegalovirus infection
dro05165  Human papillomavirus infection
dro05166  Human T-cell leukemia virus 1 infection
dro05167  Kaposi sarcoma-associated herpesvirus infection
dro05169  Epstein-Barr virus infection
dro05200  Pathways in cancer
dro05203  Viral carcinogenesis
dro05212  Pancreatic cancer
dro05214  Glioma
dro05215  Prostate cancer
dro05218  Melanoma
dro05219  Bladder cancer
dro05220  Chronic myeloid leukemia
dro05222  Small cell lung cancer
dro05223  Non-small cell lung cancer
dro05224  Breast cancer
dro05225  Hepatocellular carcinoma
dro05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112313044 (RB1)
   04218 Cellular senescence
    112313044 (RB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112313044 (RB1)
   05203 Viral carcinogenesis
    112313044 (RB1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    112313044 (RB1)
   05225 Hepatocellular carcinoma
    112313044 (RB1)
   05226 Gastric cancer
    112313044 (RB1)
   05214 Glioma
    112313044 (RB1)
   05220 Chronic myeloid leukemia
    112313044 (RB1)
   05218 Melanoma
    112313044 (RB1)
   05219 Bladder cancer
    112313044 (RB1)
   05215 Prostate cancer
    112313044 (RB1)
   05224 Breast cancer
    112313044 (RB1)
   05222 Small cell lung cancer
    112313044 (RB1)
   05223 Non-small cell lung cancer
    112313044 (RB1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    112313044 (RB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112313044 (RB1)
   05161 Hepatitis B
    112313044 (RB1)
   05160 Hepatitis C
    112313044 (RB1)
   05163 Human cytomegalovirus infection
    112313044 (RB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    112313044 (RB1)
   05169 Epstein-Barr virus infection
    112313044 (RB1)
   05165 Human papillomavirus infection
    112313044 (RB1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    112313044 (RB1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dro01009]
    112313044 (RB1)
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dro03000]
    112313044 (RB1)
Protein phosphatases and associated proteins [BR:dro01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     112313044 (RB1)
Transcription factors [BR:dro03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain Rb
    112313044 (RB1)
SSDB
Motif
Pfam: Rb_C RB_A RB_B DUF3452
Other DBs
NCBI-GeneID: 112313044
NCBI-ProteinID: XP_024425414
LinkDB
Position
Unknown
AA seq 932 aa
MPPKILRKAATAAAASPAAPVAPPLPPPPPPPPEDDPEQDSGSEDLPLARLEFEETEEPD
FTALCQKLKVPDHVRERAWLTWERVLSADGVLESYIQKKKQLWGISIFIAAVELDEMPFT
FTELQKNIEISVYKFFDLLKEIDTSTKVDNAMSRLLKKYNVLCVLYSKLERTCELIYLTQ
PSSLISTEINSVLVLKVSWITFLLAKGEVLQMEDDLVISFQLMLCVLDYFIKLSPPALLK
EPYKTAIIPINGSPRTPRRGQNRSARIAKQLENDTRVIEVLCKEHDCNIDEVKNVYFKNF
IPFMNSLGTVASNGLPEVENLSKQYEEIYLKNKDLDARLFLDHDKTLQADPTDSFEMQRT
PRRSNPDEELNVILPQTPVRTVMNTIQQLMMILNSASDQPSENLISYFNNCTVNPVESIL
KRVKDIGYIFKEKFAKAVGQGCIEIGSQRYKLGVRLYYRVMESMLKSEEERLSIQNFSKL
LNDNIFHMSLLACALEVVMATYSRSTSQNLDTGTDLSFPWILNVLNLKAFDFYKVIESFI
KAEANLTREMIKHLERCEHRIMESLAWLSDSPLFDLIKQAKDREGSAEHLESACTLNLPL
QNNHTAADMYLSPIRSPKKKGSATRVNSTANAEAQATSAFQTQKPLKSTSLSLFYKKVYR
LAYLRLNTLCARLLSDHPELEHIIWTLFQHTLQNEYELMRDRHLDQIMMCSMYGICKVKN
IDLKFKIIVTAYKELPHAVQETFKRVLIREEEYDSIIVFYNSVFMQRLKTNILQYASTRP
PTLSPIPHIPRSPYKFSSSPLRIPGGNIYISPLKNPYKISECLPTPTKMTPRSRILVSIG
ESFGTSEKFQKINQMVCNSDRVLKRSAEGSNPPKPLKKLRFDIEGSDEADGSKHLPGESK
FQQKLAEMTSTRTRMQKQKMNDSMDISNREEK
NT seq 2799 nt   +upstreamnt  +downstreamnt
atgccgcccaaaatcctccggaaagcagccactgctgctgccgcatcccccgcggcgcca
gtggcgcctccgctgccgccgcctccacctccccctccagaggacgaccccgaacaggac
agtgggtctgaggacctaccgctggctaggcttgagtttgaagaaactgaagaacctgat
tttactgcattatgtcagaaattaaaggtaccagatcatgtgagagaaagagcttggtta
acttgggagagagttttgtctgcagatggagtattggaaagttatattcagaagaaaaag
caactatggggcatcagtatctttattgcagcagttgagctagatgaaatgccatttact
tttactgagctacagaaaaacatagagatcagtgtctacaaattctttgacttactaaaa
gaaattgataccagtaccaaagttgataatgctatgtcaagactattgaagaagtataat
gtattgtgtgtactctacagcaaattagaaaggacatgtgaacttatatatttgacacaa
ccaagcagtttgatttctaccgaaataaattcagtgttggtgctaaaagtttcttggatc
acgtttttactagctaaaggagaagtattacaaatggaagatgacctggtgatctcattt
cagttaatgctgtgtgtccttgactatttcatcaaactttcacctcctgcattgctcaaa
gaaccatataaaacagctataatacctattaatggttcacctcgaacaccaaggcgaggt
cagaacaggagtgcacggatagcaaaacaactagaaaatgatacaagagttattgaagtt
ctctgtaaagaacatgactgtaatatagatgaggtgaaaaatgtttatttcaaaaatttt
ataccttttatgaattctcttggaactgtagcttctaatggacttccagaggtggaaaat
ctctctaaacaatatgaagaaatttaccttaaaaacaaagacctagatgcaagattattt
ctggatcatgataaaactcttcaggctgatcctacagacagttttgaaatgcagagaaca
ccacgaagaagtaaccctgatgaagaattaaatgtgattcttccccagactccagttagg
actgttatgaatacaattcaacaattaatgatgatcttaaattcagcaagtgatcaacca
tcagaaaatctgatttcctattttaataattgcacagtgaatccagttgaaagtatcctg
aaaagagtgaaggacattggatacatctttaaagagaaatttgctaaagctgtgggacag
ggatgtatagaaattgggtcacagcgttacaaacttggagttcgattgtattatcgagta
atggaatccatgcttaaatcagaagaagaacgattatccattcaaaattttagcaaactc
ctgaatgacaacatctttcatatgtctttgttggcatgtgctcttgaagttgtaatggct
acatatagcagaagtacatctcagaatcttgatactggaacagatttgtccttcccatgg
attctgaatgtacttaatttaaaagctttcgatttttacaaagtgattgaaagttttatc
aaagcagaagccaacttgaccagagaaatgataaaacatttagaacgttgtgaacatcga
atcatggaatcccttgcatggctctcagattcacctttatttgatcttattaaacaagca
aaggaccgggaaggatcagctgagcaccttgagtctgcttgtactctcaaccttcctctc
cagaataatcacactgcagcagatatgtatctttctcctataagatccccaaagaaaaaa
gggtcagctacacgtgtaaattctactgcaaatgcagaggcacaagcaacctcagccttc
cagactcagaagccattgaaatctacctccctttcactcttttataaaaaagtataccga
ctagcatatcttcgactaaataccctgtgtgcacgtcttctgtctgaccacccagaacta
gaacacatcatctggacccttttccagcacacactgcaaaatgagtatgaactcatgaga
gacaggcatttggaccagattatgatgtgttccatgtacggcatatgcaaagtaaagaat
atagaccttaaattcaaaatcattgtaacagcttataaggaacttcctcatgctgttcag
gagacattcaaacgggttttgatcagagaagaggaatatgattctattatagtattctat
aactcagtctttatgcagagactgaaaacaaacattttgcagtatgcttccaccaggccc
cctacattgtcaccaatacctcacattcctcgaagcccctacaagttttccagttcacct
ttacggattcctggaggaaatatctatatatcacccctgaagaatccatataagatttca
gaatgtctgccaacaccaacaaaaatgactccaagatcaagaatcttagtatccattggt
gaatcatttgggacttctgagaagttccagaaaataaatcagatggtgtgtaacagcgac
cgtgtgctcaaaagaagtgcagaaggaagcaaccctcctaaaccactaaaaaagctgcgc
tttgatattgaaggatcagatgaagcagatggaagtaaacatctcccaggggagtccaaa
tttcaacagaaactggcagaaatgacatctactcgaacacggatgcaaaagcagaaaatg
aatgatagcatggatatctccaacagggaagaaaagtga

DBGET integrated database retrieval system