KEGG   Desmodus rotundus (common vampire bat): 112313317
Entry
112313317         CDS       T05907                                 

Gene name
IL3RA
Definition
(RefSeq) interleukin-3 receptor subunit alpha
  KO
K04737  interleukin 3 receptor alpha
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04060  Cytokine-cytokine receptor interaction
dro04151  PI3K-Akt signaling pathway
dro04210  Apoptosis
dro04630  JAK-STAT signaling pathway
dro04640  Hematopoietic cell lineage
dro05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    112313317 (IL3RA)
   04151 PI3K-Akt signaling pathway
    112313317 (IL3RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    112313317 (IL3RA)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    112313317 (IL3RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    112313317 (IL3RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112313317 (IL3RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:dro04050]
    112313317 (IL3RA)
   04090 CD molecules [BR:dro04090]
    112313317 (IL3RA)
Cytokine receptors [BR:dro04050]
 Interleukin receptor families
  IL3 receptor family
   112313317 (IL3RA)
CD molecules [BR:dro04090]
 Proteins
  112313317 (IL3RA)
SSDB
Motif
Pfam: IL3Ra_N IL6Ra-bind EpoR_lig-bind
Other DBs
NCBI-GeneID: 112313317
NCBI-ProteinID: XP_024425623
LinkDB
Position
Unknown
AA seq 504 aa
MALLRLVVLLMPVCCVLPLDPGLNPPITNLRLDPRSKRLTWDLRGNVSSIKCYVNGGSRK
TAKNNRYCPVYVFPKCKAWNYTVHATLPSGERFSTWIEYPRQEGNLRAAAQHLQCRLHDL
QTLTCSWAVGAEAPRDVQYDFYVEDIISTDTWSCPHYTEMGPGTHVQCQFADVSRFPADE
DENRLYRFVVQGASREARVPCSEIFKSFSDIEELIAPNLTANCNKSVALLQWKMLSHFRK
TFEYELKIEKGSEVTIIQNDLSKDAWLLPNPGTFTVTIRATGGRWSSPQRFVCDQEDRAS
LSVWLIPLATPLVVGAAILLCKKYAVLQRLFPPIPHMKDPIRDNFVHEKMMAWPASAPAP
EDCPVAEVQVVKGPSHLTLGLAPAKVLGRQAASLDKDADSLVLACLHSLCSRAWGQPRAG
VVCDQEDRASLSVWLIPLATPLVVGAAILLCKKYAVLQRLFPPIPHMKDPIRDNFVHEKM
MAWPASAPAPEDCPVAEVQVVKGP
NT seq 1515 nt   +upstreamnt  +downstreamnt
atggccttgctgcggctcgtcgtcttactgatgcccgtctgctgtgtgctgccgctggac
ccaggcctcaacccgcccatcacgaacttacggctggacccacgcagtaagaggttgacc
tgggacctccgcggaaatgtttccagcatcaagtgctatgtgaatggaggttctcgcaaa
acggcaaaaaacaatcgttattgtcctgtgtacgtatttcccaaatgcaaagcctggaac
tacacggtccatgccactctgcccagcggggaacggttttccacgtggattgagtatccc
aggcaagaaggaaaccttagggcggccgcccagcacctccagtgtcggcttcatgacttg
cagaccctgacgtgcagctgggcggtgggcgcggaggccccgcgggacgtccagtatgac
ttctacgtagaggacatcatttccaccgacacctggtcgtgcccacactacactgaaatg
gggccggggacacacgtccagtgtcagtttgctgacgtctcccggtttcccgccgacgaa
gacgaaaaccgtctctaccgcttcgtggtgcagggcgccagcagagaggccagagttccc
tgctctgaaatattcaagtctttctcagacattgaggagttaatcgcacccaacctgact
gcaaactgcaataagtctgttgctctcctgcaatggaaaatgttaagccacttcaggaaa
acgtttgagtatgaactgaagatagagaagggctcagaggttaccatcattcagaacgac
ctctccaaagacgcctggctgctgcccaaccccggaaccttcacagtgaccatccgagcc
acgggcggccggtggagcagcccccagcgctttgtgtgcgaccaggaggaccgagcgagc
ctctccgtctggctgatcccactggccactccactggtggtgggggccgcgatccttctg
tgcaaaaagtacgcggtgctgcagaggctcttccctcccatccctcacatgaaagacccc
atcagggacaactttgtgcatgagaagatgatggcctggccggcgagcgcgcccgccccg
gaggactgtccagtggccgaggtgcaggttgtgaagggcccgagccacctgaccttgggg
ctggcacctgccaaggtcttgggccggcaggctgcctcgctggacaaggatgccgacagt
ctggtgctggcatgcctgcactcgctctgcagcagggcctggggccagcccagggcaggt
gtagtgtgcgaccaggaggaccgagcgagcctctccgtctggctgatcccactggccact
ccactggtggtgggggccgcgatccttctgtgcaaaaagtacgcggtgctgcagaggctc
ttccctcccatccctcacatgaaagaccccatcagggacaactttgtgcatgagaagatg
atggcctggccggcgagcgcgcccgccccggaggactgtccagtggccgaggtgcaggtt
gtgaagggcccgtga

DBGET integrated database retrieval system