KEGG   Desmodus rotundus (common vampire bat): 112313883
Entry
112313883         CDS       T05907                                 

Gene name
NLRP4
Definition
(RefSeq) NACHT, LRR and PYD domains-containing protein 4
  KO
K22265  NACHT, LRR and PYD domains-containing protein 4
Organism
dro  Desmodus rotundus (common vampire bat)
Brite
KEGG Orthology (KO) [BR:dro00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dro04131]
    112313883 (NLRP4)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:dro04054]
    112313883 (NLRP4)
Membrane trafficking [BR:dro04131]
 Autophagy
  Other autophagy associated proteins
   Others
    112313883 (NLRP4)
Pattern recognition receptors [BR:dro04054]
 Cytoplasmic pattern recognition receptors
  NOD-like receptors
   112313883 (NLRP4)
SSDB
Motif
Pfam: NACHT PYRIN NLRC4_HD2 NOD2_WH LRR_6 AAA_22 AAA_16 AAA_14 AAA_25 AAA
Other DBs
NCBI-GeneID: 112313883
NCBI-ProteinID: XP_024426268
LinkDB
Position
Unknown
AA seq 981 aa
MASSFFSEFGLMWYLGELRKDEFKKFKELLKVTPVQLGLQQMPWADVKKGTREDLANLLA
KHYGEEQAWDLTFLIFQKINRKDLCEKAKKEITGHTKIYRAHVKEKFTKMWFRDSVTRIY
DHFEKKLTQKECEHLECFLAPKESGKRTVVLTGIRGIGKTTVLMKVMLSWAEGSIYQKFS
YIFYFCCREVKQMTVTSLAELICRDWSDSLSPVAEITSDPEKLLFIIDGIEELGYDLNEP
DTDLCSDWMEQRPVRVILSSLLRKKMLPESSLLIAAATGYPQSIEDRLECPEIKILGGFH
ERERRLYFCCLFQDKNRGSKAFSFVKDNEQLFSMCEIPILCWTVCTCLKQEMEKGQDLAV
TCRRTTSLYSSFVLNLFTPKGASHPDRQSQGRLMGLCSLAVEGMWTDTFVFSKEDLRRNG
LVDSDIPALLDTKALHRHGDAENSYTFIHLCIQEFCAALFYFVRSHTNHPNPAVASMETL
VFTYLRKVKTHWVFLGCFLFGLLNEKEQQKLEAFFGSHLHQQETQQEVQQHVQSISESEH
VQGQVDFLRLCYCLFEMDNERFAKWAMNLCQVMCVFMHDKFDLEPVAYCLKHCSALKKLC
FSTQNVFVQEGTEPSISSNHLTYWYDICSVLTTNENLRELQVCHSNLQESTFVTLSSQLR
HPWCRLQKLQINDVSFSGDSWLFFEVLTHSPDLTYLDLSGTSLSRDDVALLCQALTNSAC
NIEKLLLANCGLLPEDCEGFRGVLQNSKLRLLNLSCNYLDTGMSLLCEALCHPSCALDAL
VLSCCYLNEDSWGSLPEVLLCNKTLTHLDFSTNILKHENLNLLCESLTQPGCHLKSLCLV
NCFITPEGCQDLALVFTRNPTLRNLQIGRNDIGDDGVRLLCKALVHSTCHLQILGLGACG
LTSACCEDLAYVLINCETLRSLTLTENALDHKGVLVLCQALRHPKCRLQWLGLRKAEFDE
ETQKLLTDEEQRNPSLQITDE
NT seq 2946 nt   +upstreamnt  +downstreamnt
atggcctcatctttcttttctgagtttggcctcatgtggtacctgggggagctcagaaag
gacgagttcaagaaatttaaggagctcctcaaggtaacgcctgtgcaacttggactccag
caaatgccctgggctgatgtgaagaaagggacacgggaagacctggcaaacctactggcc
aaacattatggggaagaacaagcctgggacctgaccttcctcatctttcagaagatcaat
agaaaggatctctgcgaaaaggccaagaaggagattaccggacacacaaagatataccgt
gctcacgtcaaggagaaattcaccaaaatgtggttcagggactctgtcactaggatttat
gatcatttcgagaagaaactcacccagaaggaatgcgaacatctggagtgttttttggcc
cccaaggaaagtgggaaaaggacggtggtccttacaggaatccgggggatcgggaagaca
acggtcctgatgaaggtgatgttgtcctgggcagagggctctatctaccagaagttctcc
tacatcttctacttctgctgccgggaagtgaagcagatgacagtgaccagcttggctgag
ctgatttgcagagactggtccgactccctctccccagtagcggagatcacatcggaccca
gagaaactcttgttcatcatcgatggcatcgaagaactgggatacgacctgaacgagcca
gacacggatctgtgcagcgactggatggagcagcggcccgtcagagtgatcctgagcagc
ttgctgagaaagaaaatgcttcccgagtcctcactgcttattgctgctgcaaccgggtac
ccacagagcatcgaagacaggttggagtgccctgagatcaaaatacttggggggttccat
gagagggagagaaggctgtatttctgctgcttattccaagacaagaatagaggctccaaa
gccttcagttttgtaaaagacaacgagcaactcttttccatgtgtgaaatccccattctt
tgctggactgtgtgtacttgtctgaagcaggagatggaaaaagggcaagatctggctgtg
acatgccgacggaccacctccctttattcctcttttgtcttgaacctgttcacacccaag
ggggctagtcatccagacaggcaaagccaaggccgactgatgggcttatgctccctggct
gttgagggcatgtggactgacacatttgtattcagtaaagaggatctcaggagaaatggg
ttagttgattctgacatccctgcattgctggacaccaaggctcttcacaggcacggggac
gctgagaactcatacaccttcatccacctgtgcatccaggagttctgtgctgccctgttc
tattttgtgaggagtcacaccaaccatcctaacccggctgtggcaagtatggagacactg
gtatttacttatttaaggaaagtcaagacccattgggtttttctggggtgtttcttgttt
ggccttttgaatgaaaaagaacaacagaagctggaggcattttttggctcccacctgcac
cagcaggagacacagcaggaggttcagcagcacgtccagagcataagtgagagtgaacac
gtccagggacaggtagatttcctgaggttatgttactgcctgttcgagatggacaatgaa
cgttttgcaaagtgggcaatgaacctctgccaagtcatgtgtgtttttatgcacgacaag
tttgacttggagcctgttgcctactgcttaaaacactgtagtgccttgaagaaactttgt
ttttccacccaaaatgtctttgtacaagagggcacagaaccttccatatcaagtaaccac
ttaacgtattggtatgacatctgctctgtgctcactacaaatgaaaacctcagggagctt
caagtgtgtcacagtaacctccaggagtcgacctttgtaactctgagcagtcagctgaga
catccctggtgtcgccttcaaaaacttcagataaatgatgtttccttctctggtgatagc
tggcttttcttcgaggtgctcactcatagcccagatttgacatacctggacctcagcggc
acaagtctctcccgcgatgacgtggcgctgctctgtcaagccttgaccaactcagcatgc
aacatagagaagttactgctggccaattgtggcctcttacccgaggactgtgaaggcttc
agaggtgtcctacagaactcgaagctgaggcttcttaacctatcctgcaactacctggac
acagggatgtcgctgttgtgtgaggccctgtgccacccaagctgtgctctggatgccttg
gtgttatcttgctgctacctcaatgaagatagctggggaagcctgcctgaggttcttctg
tgtaacaagaccctgacgcatctagacttcagcacaaacatcctgaaacacgaaaacttg
aaccttttgtgcgagtccttgacacagcccggctgccacctgaagtctctgtgtttggta
aactgtttcataacccccgagggctgtcaggaccttgctttggtcttcaccagaaaccca
accctgagaaatctgcaaattggtcggaacgacataggagatgatggtgtgaggctgctg
tgcaaagctctggttcattccacctgtcacttacagattcttggtctgggagcgtgcggc
ctgaccagtgcctgctgtgaggacctcgcctatgtgctcatcaactgcgagactctgaga
agcctcaccctgactgaaaacgccttggaccacaaaggggtgctagtgctgtgtcaggcc
ctgagacaccccaagtgcaggctgcagtggctggggctgaggaaagctgaatttgatgag
gagactcagaaacttctgacagatgaggaacagagaaatccctccttgcaaatcacagat
gagtga

DBGET integrated database retrieval system