KEGG   Desmodus rotundus (common vampire bat): 112314311Help
Entry
112314311         CDS       T05907                                 

Gene name
FXYD6
Definition
(RefSeq) FXYD domain-containing ion transport regulator 6
  KO
K13363  FXYD domain-containing ion transport regulator 6
Organism
dro  Desmodus rotundus (common vampire bat)
Brite
KEGG Orthology (KO) [BR:dro00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dro02000]
    112314311 (FXYD6)
Transporters [BR:dro02000]
 Other transporters
  Pores ion channels [TC:1]
   112314311 (FXYD6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP1G1_PLM_MAT8 Glycophorin_A EphA2_TM
Motif
Other DBs
NCBI-GeneID: 112314311
NCBI-ProteinID: XP_024426630
LinkDB All DBs
Position
Unknown
AA seq 95 aa AA seqDB search
MEVVLIFLCSLLAPTILASAAEQEKEKDPFHYDYQTLRIGGLVFAVVLFSVGILLILSRR
CKCNFSQKPRAPGDEEAQVENLITANATEPQKAEN
NT seq 288 nt NT seq  +upstreamnt  +downstreamnt
atggaggtggtgttgatctttctgtgcagcctgctggcccccactatcctggccagtgca
gctgagcaggagaaagaaaaggacccttttcattatgattaccagaccctgaggatcggg
ggattggtgtttgctgtggtcctcttctctgtcggaatcctcctcatcctgagtcgcaga
tgcaagtgcaacttcagtcagaagccacgggctccaggggatgaggaggcccaggtggag
aatctcatcactgcaaatgcaacagagccccagaaagcagagaactga

DBGET integrated database retrieval system