KEGG   Desmodus rotundus (common vampire bat): 112314476
Entry
112314476         CDS       T05907                                 

Definition
(RefSeq) cytochrome P450 4A6
  KO
K07425  long-chain fatty acid omega-monooxygenase [EC:1.14.14.80]
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro00071  Fatty acid degradation
dro00590  Arachidonic acid metabolism
dro00830  Retinol metabolism
dro01100  Metabolic pathways
dro03320  PPAR signaling pathway
dro04270  Vascular smooth muscle contraction
dro04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:dro00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    112314476
   00590 Arachidonic acid metabolism
    112314476
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    112314476
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    112314476
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    112314476
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    112314476
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:dro00199]
    112314476
Enzymes [BR:dro01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.80  long-chain fatty acid omega-monooxygenase
     112314476
Cytochrome P450 [BR:dro00199]
 Cytochrome P450, animal type
  CYP4 family
   112314476
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 112314476
NCBI-ProteinID: XP_024426820
LinkDB
Position
Unknown
AA seq 510 aa
MSVSVLSPTRALGSLSGLLQVASLFGLVLLLLRAAQLYLRRQWLLKALQEFPCPPSHWLF
GHQQEFQSDHELQELRKRVKKFPCACPRWMWGTNATLLVYDPDYMKMILGRSDPKAHDVY
RLLAPWIGYGLLLLDGQTWFKHRRMLTPAFHHDILKPYVGIMADSVLVMLDKWEELISQD
SHLEIFEHVSLMTPDAIMKCAFSQEGSNQTDRNSQSYLQTIGDVKNLFYSRARNLFYQND
IIYGLTPEGRWNHRACQLAHQHTDRVIKLREACLQEEGEMEEARRKRHLDFLDILLFARR
ENASSMPDKDIRAEVDTFMFEGHDTTASGISWILYALAAHPEHQHRCHKEIQSLLGDSNS
ITWDQLDQMPYTTMCIKEALRIYPPVPFIGRVLSKPITFPDGRSLPRGIKISLSFYGLHH
NPKVWPNPEVFDPSRFAPGSDLHSHAFLPFSGGPRNCIGKNFAMKELKVAVALTLLRFEL
AVDPFKVPIPVPKIVLSPKNGIHLQLRKRL
NT seq 1533 nt   +upstreamnt  +downstreamnt
atgagtgtgtccgtactgagccccaccagagccctgggcagcctctctgggctcctacag
gtggcctccctgttcggtctggttctcctgctgctcagggcagcccagctctacctgcgc
agacagtggctgctcaaagccctccaggagttcccgtgccctccttcccactggctgttc
gggcaccagcaggagttccaaagtgaccatgagctacaagagcttcgaaaaagggtaaag
aaattcccatgtgcctgtcctcgctggatgtgggggaccaacgccacgttactggtttat
gaccctgactacatgaagatgatcctgggaagatcagacccgaaggctcatgatgtatac
agacttctggctccgtggattgggtatggtttgctcctgttggatggacaaacgtggttc
aagcaccggcggatgctaaccccagccttccaccatgacatcctgaagccctacgtgggg
atcatggctgactctgttctagtgatgctggacaaatgggaggagctcatcagccaggac
tcccatctggagatctttgaacatgtctccttgatgaccccggacgccatcatgaagtgc
gccttcagccaggagggcagtaaccagacagacagaaactcccagtcctacctccagacc
attggggatgtgaaaaacctcttttattctcgagcaaggaatttattctaccagaacgac
atcatctatgggctgactcctgagggccgctggaaccaccgggcctgccagctcgcccat
cagcacacagaccgagtgatcaagctgagggaggcatgtctgcaagaggagggagagatg
gaggaagctaggagaaagagacacttggacttcctggacatcctcctctttgccagaagg
gagaatgcgagcagcatgcctgacaaggacatccgtgctgaggtggacacattcatgttc
gagggccatgacaccacagccagtggcatctcttggatcctctatgctctggctgcgcac
cccgagcatcagcacaggtgccacaaggagatccagagcctcctgggggacagcaactcc
atcacctgggatcagctggatcagatgccctacaccaccatgtgcatcaaggaggcactg
cgaatctatcctcctgtaccatttatcggcagagtgctcagcaagccaatcaccttccct
gatggccgctccttacccagaggaatcaaaatctcactttctttttatggtcttcaccac
aatccgaaggtgtggcccaacccagaggtgtttgacccttcccgttttgcaccaggttct
gatctacacagccatgctttcctgcccttctcaggaggaccgaggaactgcattgggaag
aattttgccatgaaggagctgaaggtggccgtggcattgaccctgcttcgctttgagctg
gcggttgatccatttaaagtccccatcccagtaccaaaaattgttttgagtcccaagaat
ggaatccacttgcagctgaggaagcggctctaa

DBGET integrated database retrieval system