KEGG   Desmodus rotundus (common vampire bat): 112314591
Entry
112314591         CDS       T05907                                 

Gene name
CDC20
Definition
(RefSeq) cell division cycle protein 20 homolog
  KO
K03363  cell division cycle 20, cofactor of APC complex
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04110  Cell cycle
dro04114  Oocyte meiosis
dro04120  Ubiquitin mediated proteolysis
dro05166  Human T-cell leukemia virus 1 infection
dro05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:dro00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    112314591 (CDC20)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112314591 (CDC20)
   04114 Oocyte meiosis
    112314591 (CDC20)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    112314591 (CDC20)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112314591 (CDC20)
Ubiquitin system [BR:dro04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Target recognizing subunit
     112314591 (CDC20)
Chromosome and associated proteins [BR:dro03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    112314591 (CDC20)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 Ge1_WD40 ELYS-bb
Other DBs
NCBI-GeneID: 112314591
NCBI-ProteinID: XP_024426939
LinkDB
Position
Unknown
AA seq 560 aa
MGEGDSCDGWVLKEPMNARSGDFKKRSPALLKSVRCHNLFRPDGLAGTHSKDPSPSRRFA
VMAQFVFDSDLHSLLQLDTPIPNAPPARWQRKAKETGGPAPSPMRAANRSHSAGRTPGRT
PGKSSSKAQTTPSKPGGDRYIPHRNASQMEVASFLLSKENHSENSQTPTKKEHQKAWALN
LNGFDVEEAKILRLSGKPQKVPEGYQNRLKVLYSQKATPGSSRKTCRYIPSLPDRILDAP
EIRNDYYLNLVDWSSGNVLAVALDNSVYLWSASSGDILQLLQMEQPGDYVSSVSWIKEGN
YLAVGTSNAEVQLWDVQQQKRLRNMTSHSARVGSLSWNSYILSSGSRSGHIHHHDVRVAE
HHVATLSGHSQEVCGLRWAPDGRHLASGGNDNLVNVWPSAPGEGGWVPLQTFTQHQGAVK
AVAWCPWQSSILATGGGTSDRHIRIWNVCSGACLNAVDAHSQVCSILWSSHYKELISGHG
FAQNQLVIWKYPTMGKVAELKGHTARVLSLTMSPDGATVASAAADETLRLWRCFELDPAR
RREREKASAAKSSLIHQGIR
NT seq 1683 nt   +upstreamnt  +downstreamnt
atgggagaaggcgacagttgcgacggttgggttttgaaggagccaatgaatgctcggagc
ggagactttaagaagcgtagtcccgcacttctgaagtcggtcagatgccataaccttttc
cgacctgacggactcgccggcactcactccaaggacccctccccctccagacgcttcgcg
gtcatggcgcagttcgtgttcgatagtgatctgcactcgctgctgcagctggacacaccc
atccccaatgcacccccagcgcgctggcagcgcaaagctaaggaaaccggggggccggcc
ccctcacccatgcgggccgccaatcgatcccatagcgccggcaggacccctggccgaact
cctggcaaatccagctccaaagctcagaccactcccagcaaacctggtggtgaccgctat
atcccccatcgcaatgcttctcagatggaggttgccagcttcctcctgagcaaggagaac
cactcggaaaacagccagacgcccaccaagaaggaacatcagaaagcctgggctttgaac
ctgaacggttttgatgtggaggaagccaagatcctccggcttagtggaaaaccacaaaaa
gttccagagggttaccagaatagactgaaagtactgtacagccagaaggccacgcctggc
tccagcaggaagacctgccgctacattccttccctaccagaccggatcctggatgcccct
gaaatccgtaacgactattacctaaacctggtggactggagctcagggaatgtgctggct
gtggcgttggacaacagtgtatacttgtggagtgctagctcaggtgacatcctgcagctg
ctgcagatggagcagcctggggactatgtgtcttctgtgtcctggatcaaagagggcaac
tacctggctgtgggcaccagcaatgctgaggtgcagctatgggatgtgcagcagcagaag
cggcttcggaacatgaccagtcattccgcccgagtgggctccctaagttggaatagctat
atcctgtccagtggctcacgctctggccacatccaccaccatgatgttcgggtagcagag
caccatgtggccacactgagtggtcacagccaggaagtgtgtgggctgcgctgggcccca
gatggacgacatttggccagtggtggcaacgataacttggtcaatgtgtggcctagtgct
cctggagaggggggctgggttcccctgcagacattcacacagcatcaaggggctgtcaag
gctgtagcttggtgtccctggcagtccagtatcctggcaactggaggcggcaccagtgat
cgacacattcgcatctggaacgtctgctctggggcctgtctgaatgctgtggatgcccac
tcccaggtgtgctctatcctctggtcttcccactacaaagaactcatctcaggccatggc
tttgcccagaaccagctggttatttggaagtaccctaccatgggcaaggtagctgagctc
aaaggtcacacagcccgggtcctaagtctgaccatgagcccagacggagccacggtggca
tcagcagcagcagatgagactctacggctgtggcgctgctttgagttggaccccgcgcgg
cggcgggaacgggagaaggctagtgcagccaaaagcagcctcatccatcaaggcatccgt
tga

DBGET integrated database retrieval system