KEGG   Desmodus rotundus (common vampire bat): 112315389
Entry
112315389         CDS       T05907                                 

Gene name
KITLG
Definition
(RefSeq) kit ligand isoform X1
  KO
K05461  KIT ligand
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04010  MAPK signaling pathway
dro04014  Ras signaling pathway
dro04015  Rap1 signaling pathway
dro04072  Phospholipase D signaling pathway
dro04151  PI3K-Akt signaling pathway
dro04640  Hematopoietic cell lineage
dro04916  Melanogenesis
dro05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112315389 (KITLG)
   04014 Ras signaling pathway
    112315389 (KITLG)
   04015 Rap1 signaling pathway
    112315389 (KITLG)
   04072 Phospholipase D signaling pathway
    112315389 (KITLG)
   04151 PI3K-Akt signaling pathway
    112315389 (KITLG)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    112315389 (KITLG)
  09152 Endocrine system
   04916 Melanogenesis
    112315389 (KITLG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112315389 (KITLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:dro04052]
    112315389 (KITLG)
Cytokines and growth factors [BR:dro04052]
 Growth factors
  Growth factors (RTK binding)
   112315389 (KITLG)
SSDB
Motif
Pfam: SCF
Other DBs
NCBI-GeneID: 112315389
NCBI-ProteinID: XP_024427876
LinkDB
Position
Unknown
AA seq 296 aa
MKKTQTWIITCIYLQLLLFNPPVRTTGICMNRVTDDVKDVTKLVANLPKDYKITLKYVPG
MDILPRHCWISEMVEQLSVSLTDLLDKFSNISEGLSNYSIIDKLVKIVDDLVECMEGHPF
ENVKKSSKSLEPKLFTPEEFFRIFNRSIDAFKHLEMVSPRTSECVVPSTLSPGEDSRVSV
TKAFMLPPVAANSLRNDSSSSNRKASYSVGASHLQWAAIVLPALVSLIVGFGIGALYWKK
KQPNPTRAVENIQITEEDNEIRYFGLLNVCTSKRDIVISCTMPIVIASGRRCSLSP
NT seq 891 nt   +upstreamnt  +downstreamnt
atgaagaagacacaaacttggattatcacttgcatttatcttcaactgctcctctttaat
cctcccgtgagaactacagggatctgcatgaaccgcgtcactgacgatgtgaaggacgtc
acgaaattggtggcaaatcttccaaaagactataaaataaccctcaagtatgtccccggg
atggacattttgcctaggcattgttggataagcgaaatggtggaacaactgtcagtcagc
ttgactgatcttctggacaaattttcaaatatttctgaaggcttgagtaactactctatc
atagacaaacttgtgaaaatagtggatgaccttgtggagtgcatggaaggacacccattt
gagaatgtaaaaaaatcatctaagagcttagaacccaagctgtttactcctgaagaattc
tttagaatttttaatagatccatcgatgccttcaagcacttggagatggtgtcacctaga
actagtgaatgtgtggttccttctacattaagtcctggagaagattccagagtcagtgtc
acaaaagcatttatgttaccccctgttgcagccaactcccttaggaatgacagcagtagc
agtaataggaaggcctcgtactccgtgggagcctcccacctgcaatgggcagccatagta
ttgccagcactcgtctccctcatagttggctttggaattggagccttatactggaagaag
aaacaaccaaatcctacaagggcagtcgaaaatatacagattactgaagaggataatgag
ataaggtattttggtttattaaatgtgtgcacaagtaagcgtgacattgtcatttcatgt
accatgcccattgtcatagcgtctggaagaagatgctcactctcaccatag

DBGET integrated database retrieval system