KEGG   Desmodus rotundus (common vampire bat): 112315592
Entry
112315592         CDS       T05907                                 

Gene name
MYC
Definition
(RefSeq) myc proto-oncogene protein
  KO
K04377  Myc proto-oncogene protein
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04010  MAPK signaling pathway
dro04012  ErbB signaling pathway
dro04110  Cell cycle
dro04151  PI3K-Akt signaling pathway
dro04218  Cellular senescence
dro04310  Wnt signaling pathway
dro04350  TGF-beta signaling pathway
dro04390  Hippo signaling pathway
dro04550  Signaling pathways regulating pluripotency of stem cells
dro04630  JAK-STAT signaling pathway
dro04919  Thyroid hormone signaling pathway
dro05132  Salmonella infection
dro05160  Hepatitis C
dro05161  Hepatitis B
dro05163  Human cytomegalovirus infection
dro05166  Human T-cell leukemia virus 1 infection
dro05167  Kaposi sarcoma-associated herpesvirus infection
dro05169  Epstein-Barr virus infection
dro05200  Pathways in cancer
dro05202  Transcriptional misregulation in cancer
dro05205  Proteoglycans in cancer
dro05206  MicroRNAs in cancer
dro05210  Colorectal cancer
dro05213  Endometrial cancer
dro05216  Thyroid cancer
dro05219  Bladder cancer
dro05220  Chronic myeloid leukemia
dro05221  Acute myeloid leukemia
dro05222  Small cell lung cancer
dro05224  Breast cancer
dro05225  Hepatocellular carcinoma
dro05226  Gastric cancer
dro05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112315592 (MYC)
   04012 ErbB signaling pathway
    112315592 (MYC)
   04310 Wnt signaling pathway
    112315592 (MYC)
   04350 TGF-beta signaling pathway
    112315592 (MYC)
   04390 Hippo signaling pathway
    112315592 (MYC)
   04630 JAK-STAT signaling pathway
    112315592 (MYC)
   04151 PI3K-Akt signaling pathway
    112315592 (MYC)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112315592 (MYC)
   04218 Cellular senescence
    112315592 (MYC)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    112315592 (MYC)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    112315592 (MYC)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112315592 (MYC)
   05202 Transcriptional misregulation in cancer
    112315592 (MYC)
   05206 MicroRNAs in cancer
    112315592 (MYC)
   05205 Proteoglycans in cancer
    112315592 (MYC)
   05230 Central carbon metabolism in cancer
    112315592 (MYC)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112315592 (MYC)
   05225 Hepatocellular carcinoma
    112315592 (MYC)
   05226 Gastric cancer
    112315592 (MYC)
   05216 Thyroid cancer
    112315592 (MYC)
   05221 Acute myeloid leukemia
    112315592 (MYC)
   05220 Chronic myeloid leukemia
    112315592 (MYC)
   05219 Bladder cancer
    112315592 (MYC)
   05213 Endometrial cancer
    112315592 (MYC)
   05224 Breast cancer
    112315592 (MYC)
   05222 Small cell lung cancer
    112315592 (MYC)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112315592 (MYC)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112315592 (MYC)
   05161 Hepatitis B
    112315592 (MYC)
   05160 Hepatitis C
    112315592 (MYC)
   05163 Human cytomegalovirus infection
    112315592 (MYC)
   05167 Kaposi sarcoma-associated herpesvirus infection
    112315592 (MYC)
   05169 Epstein-Barr virus infection
    112315592 (MYC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dro03000]
    112315592 (MYC)
   03019 Messenger RNA biogenesis [BR:dro03019]
    112315592 (MYC)
Transcription factors [BR:dro03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Myc
    112315592 (MYC)
Messenger RNA biogenesis [BR:dro03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     112315592 (MYC)
SSDB
Motif
Pfam: Myc_N Myc-LZ HLH
Other DBs
NCBI-GeneID: 112315592
NCBI-ProteinID: XP_024428103
LinkDB
Position
Unknown
AA seq 439 aa
MPLNVSFANRNYDLDYDSMQPYFFCDEEENFYHQQQQSELQPPAPSEDIWKKFELLPTPP
LSPSRRSGLCSPSYVAFASFSPRDVDDGGGGSFSTADQLEMVTELLGGDMVNQSFICDPD
DETLIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDGGSRSPARGHGACSTSSLYLQD
LSAAASECIDPSVVFPYPLNDSSSPKPCSSPDSTAFSPSSDSLLSSASSSPRATPEPLTL
HEDTPPTTSSDSEEEQEDEEEIDVVSVEKRQPPAKRSESGSPSSGSHSKPPHSPLVLKRC
HVSTHQHNYAASPSTRKDYPPSKRAKLDSGRVLKQISNNRKCSSPRASDTEENDKRRTHN
VLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILAIQAEEQKLISEKDVL
RKRREQLKHKLEQLRNSCA
NT seq 1320 nt   +upstreamnt  +downstreamnt
atgcccctcaacgtcagcttcgccaacaggaactatgacctcgactacgactcgatgcag
ccctatttcttctgtgacgaggaagagaacttctaccaccaacaacagcagagcgagcta
cagcctccggcgcccagcgaggatatctggaagaaattcgagctgctgcccaccccgccc
ctgtcgcccagccgccgctctgggctctgctcgccctcctacgttgcgttcgcgtccttc
tcccccagggatgttgatgacggcggcggtggcagcttttccaccgcagaccagctggag
atggtcaccgagctgctgggaggagacatggtgaaccagagcttcatctgcgacccggac
gacgagacgcttatcaaaaacatcatcatccaggactgtatgtggagcggcttctctgcc
gccgccaagctggtctccgagaagctggcctcctaccaggctgcgcgaaaagacggcggc
agccggagccccgcccgagggcatggcgcctgctccacctccagcctgtacctgcaggac
ctgagcgccgccgcctctgaatgcatcgacccctccgtggtcttcccctaccctctcaat
gacagcagctcgcccaagccctgctcctcccctgattccaccgccttctctccgtcctcg
gactcgctgctctcctcggcctcctcctccccacgggccacccccgagcccctgaccctc
cacgaagacacaccacccaccaccagcagcgactctgaggaagaacaagaagatgaggaa
gaaattgatgttgtttctgtggaaaagaggcagccccctgccaaaaggtcagaatcgggg
tcaccctcttccggaagtcacagcaaacctcctcacagcccactggtccttaagagatgc
cacgtgtctactcatcagcacaattacgcagcgtccccctccactaggaaggactaccct
ccctccaagagggccaagttggacagtggcagagtcctgaagcagatcagcaacaaccgc
aaatgctccagccccagggcctccgacacagaggagaacgacaagaggcgaacccacaac
gtcctggagcgccagaggagaaacgagctgaaacgcagctttttcgccctgcgcgaccag
atcccggagttggaaaacaacgaaaaagcccccaaggtagttatccttaaaaaagcaacg
gcttacatcctggccatccaagcggaggagcaaaagctcatttcagaaaaggacgtattg
cggaaacgacgggaacagttgaaacacaaacttgaacagctacggaactcttgtgcataa

DBGET integrated database retrieval system