KEGG   Desmodus rotundus (common vampire bat): 112315924Help
Entry
112315924         CDS       T05907                                 

Definition
(RefSeq) neuronal acetylcholine receptor subunit alpha-10
  KO
K04811  nicotinic acetylcholine receptor alpha-10
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    112315924
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:dro04040]
    112315924
Ion channels [BR:dro04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   112315924
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Motif
Other DBs
NCBI-GeneID: 112315924
NCBI-ProteinID: XP_024428354
LinkDB All DBs
Position
Unknown
AA seq 454 aa AA seqDB search
MGHRSRLFGLDFSVSRLGLLLLLPLLPECLGAEGKLAYKLFRDLFSNYTSALRPVADTDQ
ALNVTLEVTLSQIIDMDERNQVLTLYLWIRQEWTDAHLRWDPDDYGGLDAIRIPSSLVWR
PDIVLYNKADSQPPASASTNVVLRHDGAVRWDAPAITRSSCSVDVSAFPFDSQRCGLMFG
SWTHGGHQLDLQPRGDRASLADFVENVEWRVLGMPAQRRVLTYGCCSEPYPDVTFTLLLR
RRAAAYVCNLLLPCVLISLLAPLAFHLPADSGEKVSLGVTVLLSLTVFQLLLADSMPPAE
SVPLIGKYYMATMTMVTFSTALTILLMNLHYCGPSARPVPAWARAFLLGHLARGLCVRER
GEPCGQSRRPESPPSPQPPAGPPAGPCHESRCLCHQEALLHHVATIANTFRSHRAAQHRH
EDWKHLARVMDRFFLGIFFSMALVMSLLVLVQAL
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atggggcacaggagccgcctctttggccttgacttctctgtctccagactgggccttctg
ctcctgctcccactccttccagagtgcttgggagctgagggcaagctggcttacaagctg
ttccgtgacctcttctcaaactacacaagtgccctgaggcctgtggcagacacagaccag
gctctgaacgtgactctggaggtgacattgtcccagatcatcgacatggatgagcgcaac
caggtgctgaccctgtacctgtggattcgacaggaatggacagatgcccacctacgatgg
gaccctgatgactatggtggcctggatgccatccgcatccccagcagtcttgtgtggcgg
ccagacatcgtactctataacaaggcagactcgcagcccccagcctcggccagcaccaac
gtagttctgcgacacgacggtgcagtgcgctgggatgcgccggccatcacgcgcagctcg
tgcagcgtggacgtgtcagccttcccattcgactcgcagcgctgcggcctgatgttcggc
tcgtggacgcacggtgggcaccagctagacctgcagccgcgcggcgaccgcgccagcctg
gccgacttcgtggaaaacgtggagtggcgcgtgctgggcatgccagcgcagcggcgtgtg
ctcacctacggctgctgctcggagccctacccggatgtgaccttcacgctgctgctccgc
cgccgcgcagccgcctacgtgtgcaacctgctgctgccctgtgtgctcatctccctgctc
gcaccgctcgccttccacctgcctgccgactccggtgagaaggtgtcgctgggcgtcacc
gtgctgctgtctctcactgtcttccagctgctcctggccgacagcatgccaccggccgag
agcgtgccgctaatcgggaagtactacatggccaccatgaccatggtcaccttctccacg
gcgctcactatccttctcatgaacctgcattactgtggtcccagtgcccgcccagtgcca
gcctgggctcgagctttcctactgggacacctggcacggggcctgtgtgtgagggaacga
ggggagccctgtgggcagtctagacggcctgagtcacctcccagtccccagcctcctgct
ggccccccagctggcccttgccatgagtcccggtgtctctgccatcaggaagccctgctg
caccacgtagccaccattgccaacaccttccgtagccaccgggctgcccagcaccgccat
gaggactggaaacacctggcccgtgtgatggaccgcttcttcctgggcatcttcttctcc
atggccctggtcatgagcctcctggtgctggtgcaggccctgtga

DBGET integrated database retrieval system