KEGG   Desmodus rotundus (common vampire bat): 112316527
Entry
112316527         CDS       T05907                                 

Gene name
RPS6KB1
Definition
(RefSeq) ribosomal protein S6 kinase beta-1 isoform X1
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro01521  EGFR tyrosine kinase inhibitor resistance
dro01522  Endocrine resistance
dro04012  ErbB signaling pathway
dro04066  HIF-1 signaling pathway
dro04140  Autophagy - animal
dro04150  mTOR signaling pathway
dro04151  PI3K-Akt signaling pathway
dro04152  AMPK signaling pathway
dro04211  Longevity regulating pathway
dro04213  Longevity regulating pathway - multiple species
dro04350  TGF-beta signaling pathway
dro04371  Apelin signaling pathway
dro04666  Fc gamma R-mediated phagocytosis
dro04714  Thermogenesis
dro04910  Insulin signaling pathway
dro04931  Insulin resistance
dro05163  Human cytomegalovirus infection
dro05165  Human papillomavirus infection
dro05170  Human immunodeficiency virus 1 infection
dro05200  Pathways in cancer
dro05205  Proteoglycans in cancer
dro05210  Colorectal cancer
dro05212  Pancreatic cancer
dro05221  Acute myeloid leukemia
dro05224  Breast cancer
dro05225  Hepatocellular carcinoma
dro05226  Gastric cancer
dro05231  Choline metabolism in cancer
dro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    112316527 (RPS6KB1)
   04350 TGF-beta signaling pathway
    112316527 (RPS6KB1)
   04371 Apelin signaling pathway
    112316527 (RPS6KB1)
   04066 HIF-1 signaling pathway
    112316527 (RPS6KB1)
   04151 PI3K-Akt signaling pathway
    112316527 (RPS6KB1)
   04152 AMPK signaling pathway
    112316527 (RPS6KB1)
   04150 mTOR signaling pathway
    112316527 (RPS6KB1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112316527 (RPS6KB1)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    112316527 (RPS6KB1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    112316527 (RPS6KB1)
  09149 Aging
   04211 Longevity regulating pathway
    112316527 (RPS6KB1)
   04213 Longevity regulating pathway - multiple species
    112316527 (RPS6KB1)
  09159 Environmental adaptation
   04714 Thermogenesis
    112316527 (RPS6KB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112316527 (RPS6KB1)
   05205 Proteoglycans in cancer
    112316527 (RPS6KB1)
   05231 Choline metabolism in cancer
    112316527 (RPS6KB1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    112316527 (RPS6KB1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112316527 (RPS6KB1)
   05212 Pancreatic cancer
    112316527 (RPS6KB1)
   05225 Hepatocellular carcinoma
    112316527 (RPS6KB1)
   05226 Gastric cancer
    112316527 (RPS6KB1)
   05221 Acute myeloid leukemia
    112316527 (RPS6KB1)
   05224 Breast cancer
    112316527 (RPS6KB1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    112316527 (RPS6KB1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    112316527 (RPS6KB1)
   05163 Human cytomegalovirus infection
    112316527 (RPS6KB1)
   05165 Human papillomavirus infection
    112316527 (RPS6KB1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    112316527 (RPS6KB1)
   01522 Endocrine resistance
    112316527 (RPS6KB1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dro01001]
    112316527 (RPS6KB1)
Enzymes [BR:dro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112316527 (RPS6KB1)
Protein kinases [BR:dro01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   112316527 (RPS6KB1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_C Kinase-like Pkinase_fungal APH
Other DBs
NCBI-GeneID: 112316527
NCBI-ProteinID: XP_024429166
LinkDB
Position
Unknown
AA seq 525 aa
MRRRRRRDGFYPAPDFRDREAEDMAGVFDIDLDQPEDAGSEDELEEGGQLNESMDHGGVG
PYELGMEHCEKFEISETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVTGANTGKIF
AMKVLKKAMIVRNAKDTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGEL
FMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLC
KESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKK
TIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQAHPFFRHINWEEL
LARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDSTLSESANQVFLGFTYVAPSVLE
SVKEKFSFEPKIRSPRRFIGSPRTPVSPVKFSPGDFWGRGASASTANPQTPVEYPMETSG
IEQMDVTMSGEASAPLPIRQPNSGPYKKQAFPMISKRPEHLRMNL
NT seq 1578 nt   +upstreamnt  +downstreamnt
atgaggcgacgacggaggcgggacggcttttacccagcgccggacttccgagacagggaa
gctgaggacatggcaggagtgtttgacatagacctggaccagccagaagacgcgggctct
gaggatgagctggaggaggggggtcagttaaatgaaagcatggaccatgggggagttgga
ccatatgaacttggcatggaacattgtgagaaatttgaaatctcagaaactagtgtgaac
agagggccagaaaaaatcagaccagaatgttttgagctacttcgggtacttggtaaaggg
ggctatggaaaggttttccaagtacgaaaagtaacaggagcaaatactgggaaaatattt
gccatgaaggtgcttaaaaaggcaatgatagtaagaaatgctaaagatacagctcataca
aaagcagaacggaatattctggaggaagtaaagcatcccttcattgtggatttaatttat
gcctttcagactggtggaaaactctacctcatccttgagtatctcagcggaggagaatta
tttatgcagttagaaagagagggaatatttatggaagacacagcctgcttttacttggca
gaaatctccatggctttggggcatttacatcaaaaggggatcatctacagagacctgaag
ccggagaatatcatgcttaatcaccaaggtcacgtgaaactaacagactttggactatgc
aaagaatctattcatgatggaacagtcacacacacattttgtggaacaatagaatacatg
gcccctgaaatcttgatgcgaagtggccacaatcgtgctgtggattggtggagtttggga
gcattaatgtatgacatgctgactggagcacccccgttcactggggagaatagaaagaaa
acgattgacaaaatcctcaaatgtaaactcaatttgcctccctacctcacacaagaagcc
agagatctgcttaaaaagctgctgaaaagaaatgctgcttctcgtctcggagctggtcct
ggggatgctggagaagttcaagctcatccatttttcagacatattaactgggaagaattg
ctggctcggaaggtggagcccccctttaaacctctattgcaatctgaagaggacgtgagt
cagtttgattcaaagtttacacgtcagacgcctgttgacagcccggatgactcaactctc
agtgaaagtgccaaccaggtctttctgggttttacatatgtggctccatctgtacttgaa
agcgtgaaagaaaagttttcctttgaaccaaaaatccgatcacctcgaagatttattggc
agcccacgaacacctgtcagcccagtcaaattttctcctggggatttctggggaagaggt
gcttcagccagcacagcaaatcctcagacgcctgtggaatacccaatggaaacgagtgga
atagagcagatggatgtgacgatgagtggggaagcttcagccccacttccaatacgacag
ccgaactccgggccatacaaaaaacaagcttttcccatgatctccaaacgaccagagcac
ctacgtatgaatctatga

KEGG   Desmodus rotundus (common vampire bat): 112317229
Entry
112317229         CDS       T05907                                 

Gene name
RPS6KB2
Definition
(RefSeq) ribosomal protein S6 kinase beta-2
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro01521  EGFR tyrosine kinase inhibitor resistance
dro01522  Endocrine resistance
dro04012  ErbB signaling pathway
dro04066  HIF-1 signaling pathway
dro04140  Autophagy - animal
dro04150  mTOR signaling pathway
dro04151  PI3K-Akt signaling pathway
dro04152  AMPK signaling pathway
dro04211  Longevity regulating pathway
dro04213  Longevity regulating pathway - multiple species
dro04350  TGF-beta signaling pathway
dro04371  Apelin signaling pathway
dro04666  Fc gamma R-mediated phagocytosis
dro04714  Thermogenesis
dro04910  Insulin signaling pathway
dro04931  Insulin resistance
dro05163  Human cytomegalovirus infection
dro05165  Human papillomavirus infection
dro05170  Human immunodeficiency virus 1 infection
dro05200  Pathways in cancer
dro05205  Proteoglycans in cancer
dro05210  Colorectal cancer
dro05212  Pancreatic cancer
dro05221  Acute myeloid leukemia
dro05224  Breast cancer
dro05225  Hepatocellular carcinoma
dro05226  Gastric cancer
dro05231  Choline metabolism in cancer
dro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    112317229 (RPS6KB2)
   04350 TGF-beta signaling pathway
    112317229 (RPS6KB2)
   04371 Apelin signaling pathway
    112317229 (RPS6KB2)
   04066 HIF-1 signaling pathway
    112317229 (RPS6KB2)
   04151 PI3K-Akt signaling pathway
    112317229 (RPS6KB2)
   04152 AMPK signaling pathway
    112317229 (RPS6KB2)
   04150 mTOR signaling pathway
    112317229 (RPS6KB2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112317229 (RPS6KB2)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    112317229 (RPS6KB2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    112317229 (RPS6KB2)
  09149 Aging
   04211 Longevity regulating pathway
    112317229 (RPS6KB2)
   04213 Longevity regulating pathway - multiple species
    112317229 (RPS6KB2)
  09159 Environmental adaptation
   04714 Thermogenesis
    112317229 (RPS6KB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112317229 (RPS6KB2)
   05205 Proteoglycans in cancer
    112317229 (RPS6KB2)
   05231 Choline metabolism in cancer
    112317229 (RPS6KB2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    112317229 (RPS6KB2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112317229 (RPS6KB2)
   05212 Pancreatic cancer
    112317229 (RPS6KB2)
   05225 Hepatocellular carcinoma
    112317229 (RPS6KB2)
   05226 Gastric cancer
    112317229 (RPS6KB2)
   05221 Acute myeloid leukemia
    112317229 (RPS6KB2)
   05224 Breast cancer
    112317229 (RPS6KB2)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    112317229 (RPS6KB2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    112317229 (RPS6KB2)
   05163 Human cytomegalovirus infection
    112317229 (RPS6KB2)
   05165 Human papillomavirus infection
    112317229 (RPS6KB2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    112317229 (RPS6KB2)
   01522 Endocrine resistance
    112317229 (RPS6KB2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dro01001]
    112317229 (RPS6KB2)
Enzymes [BR:dro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112317229 (RPS6KB2)
Protein kinases [BR:dro01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   112317229 (RPS6KB2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_C Kinase-like Pkinase_fungal Seadorna_VP7 Kdo
Other DBs
NCBI-GeneID: 112317229
NCBI-ProteinID: XP_024430072
LinkDB
Position
Unknown
AA seq 482 aa
MAAVFDLDLETEEDSEGEGEPEFPADVCPLAELRAAGLEPVGHCEEVELTETSVNPSPER
IGPHCFELLRVLGKGGYGKVFQVRKVQGTNLGKIYAMKVLRKAKIVCNAKDTAHTRAERN
ILESVKHPFIVELAYAFQTGGKLYLILECLSGGELFTHLEREGIFLEDTACFYLGEITLA
LGHLHSQGIIYRDLKPENIMLNSQGHIKLTDFGLCKESIHEGAVTHTFCGTIEYMAPEVL
ARSGHSWAVDWWSLGALMYDMLTGSPPFTAENRKKTMDKIIKGKLALPPYLTPDARDLIK
KFLKRNPSQRIGGGPGDAADVQRHPFFRHINWDDLLARRMDPPFRPCLQSEEDVSQFDTR
FTRQTPVDSPDDTALSESANQAFLGFTYVAPSVLDSIKEGFTFQPKLRSPRRLNSSPRTP
ISPLKFSPFEGFRPSSGPPEPMEPPLPPLMPPPPPPSSTVPLPIRLPSGTKKSKRGRGRP
GR
NT seq 1449 nt   +upstreamnt  +downstreamnt
atggcggccgtgtttgacctggatctggagacggaggaagacagcgagggcgagggcgag
ccagagttccctgcggacgtgtgtccccttgccgagttgagggcggctggcctggagcct
gtgggacactgtgaggaggtggagctgactgagaccagtgtgaaccctagccctgagcgc
attgggccccactgctttgagctgctgcgtgtgctgggcaaggggggctatggcaaggtg
ttccaggtgcgaaaggtgcagggcaccaacttgggcaaaatatatgccatgaaagtcctg
aggaaggccaaaatcgtgtgcaacgccaaggacacagcacacacacgggccgagcggaac
attctggagtctgtgaagcatcccttcattgtggagctggcctatgccttccagactggc
ggcaagctctacctcatcctcgagtgcctcagtggcggtgagctcttcacgcacttggag
cgagagggcatcttcctggaagacacagcctgcttctacctgggagagatcacactggcc
ctgggccacctgcactcccagggcatcatctaccgggacctcaaacccgagaacatcatg
ctgaacagccagggccacatcaaactgacagattttgggctctgcaaggagtcgattcac
gagggtgccgtcacccacaccttctgtggcaccattgagtacatggcccctgaggtcctg
gcgcgcagcggccacagctgggcagtggactggtggagcctgggggccctgatgtacgac
atgctcactggatcgccgcccttcactgcagagaaccggaagaaaaccatggacaagatc
atcaaagggaagctggcgctgcccccgtacctcaccccggatgcccgggacctcatcaaa
aagtttctgaagcggaatcccagccagcggattgggggtggcccaggggacgctgctgat
gtgcagaggcacccctttttccggcacattaattgggatgatctcctggcccgccgcatg
gacccccctttcaggccctgtctgcagtcggaggaggacgtgagccagtttgacacccgc
ttcacacggcagacgccggtggacagtccagacgacacggccctcagcgagagtgccaac
caggctttcctgggcttcacatacgtggcgccctctgtcctggacagcatcaaggagggc
ttcaccttccagcccaagctgcgctccccccggcgcctcaacagcagcccccggactcct
atcagccccctgaagttctcaccctttgaggggttccgacccagctctggaccaccagag
cccatggagccccctctgcctcctctgatgccaccaccgccaccaccctcaagcactgtc
cccctccccatccgactgccctcagggaccaagaagtccaagaggggccgcgggcgccct
gggcgctaa

DBGET integrated database retrieval system