KEGG   Desmodus rotundus (common vampire bat): 112316918
Entry
112316918         CDS       T05907                                 

Gene name
PDGFRA
Definition
(RefSeq) platelet-derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro01521  EGFR tyrosine kinase inhibitor resistance
dro04010  MAPK signaling pathway
dro04014  Ras signaling pathway
dro04015  Rap1 signaling pathway
dro04020  Calcium signaling pathway
dro04072  Phospholipase D signaling pathway
dro04144  Endocytosis
dro04151  PI3K-Akt signaling pathway
dro04510  Focal adhesion
dro04540  Gap junction
dro04630  JAK-STAT signaling pathway
dro04810  Regulation of actin cytoskeleton
dro05163  Human cytomegalovirus infection
dro05200  Pathways in cancer
dro05206  MicroRNAs in cancer
dro05214  Glioma
dro05215  Prostate cancer
dro05218  Melanoma
dro05230  Central carbon metabolism in cancer
dro05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112316918 (PDGFRA)
   04014 Ras signaling pathway
    112316918 (PDGFRA)
   04015 Rap1 signaling pathway
    112316918 (PDGFRA)
   04630 JAK-STAT signaling pathway
    112316918 (PDGFRA)
   04020 Calcium signaling pathway
    112316918 (PDGFRA)
   04072 Phospholipase D signaling pathway
    112316918 (PDGFRA)
   04151 PI3K-Akt signaling pathway
    112316918 (PDGFRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112316918 (PDGFRA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112316918 (PDGFRA)
   04540 Gap junction
    112316918 (PDGFRA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112316918 (PDGFRA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112316918 (PDGFRA)
   05206 MicroRNAs in cancer
    112316918 (PDGFRA)
   05230 Central carbon metabolism in cancer
    112316918 (PDGFRA)
   05231 Choline metabolism in cancer
    112316918 (PDGFRA)
  09162 Cancer: specific types
   05214 Glioma
    112316918 (PDGFRA)
   05218 Melanoma
    112316918 (PDGFRA)
   05215 Prostate cancer
    112316918 (PDGFRA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    112316918 (PDGFRA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    112316918 (PDGFRA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dro01001]
    112316918 (PDGFRA)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:dro04090]
    112316918 (PDGFRA)
Enzymes [BR:dro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     112316918 (PDGFRA)
Protein kinases [BR:dro01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   112316918 (PDGFRA)
CD molecules [BR:dro04090]
 Proteins
  112316918 (PDGFRA)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 V-set Herpes_gE C1-set Kinase-like DUF3475
Other DBs
NCBI-GeneID: 112316918
NCBI-ProteinID: XP_024429675
LinkDB
Position
Unknown
AA seq 1089 aa
MGTSHLALLVLGCLLAGPSLIFCQLSLPSILPNENEKVVQLNSSFSLRCLGESEVSWLYP
ISEDKKANVTIRSEENNSGLFVKVLEVASASAAHTGLYTCYYNHTQTEESEVEGSHIYIY
VPDPDVAFVPLGMTDYLVIVENDDFAIIPCRTTDPQTPVTLLSRDGVVLAAYDSRQGFNG
SFTGGPYICEAIVRGKKFQTIPFNIYALKATSELDLELEAPKTVYKSGETIALTCIVFNN
EVVDFQWTYPGEVKSKGVVMLEEIKDPSLKLVYTLMVPKATVKDSGDYECVARQATSEVK
EMKKVTISVHEKGFIEIQPYFSQLEAVNLHEVKHFVVDVQAYPPPRISWLKDNLTLIENL
TEITTDIEKIQEIRYRSKLKLIRAKEEDSGHYTIVVQNEDDMKSYTFELLTQVPSSILDL
VDDHHGSTGAQTVRCTAAGTPLPDIEWMICKDIKKCNNETSWTILASNISNIITEVHPLD
RSVVEGQVTFAKVEETIAVRCLAKNLLGADNRELKLVAPTLRSELTVAAAVLVLLVIVII
SLIVLVVIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRILG
SGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNL
LGACTKSGPIYIITEYCFYGDLVNYLHKNRDSFLSHHPEKPKKELDIFGLNPTDESTRSY
VVLSFENNGDYMDMKQADTTQYVPMLERKEVSKYSDIQRSLYDRPASYKKKSMLESEVKN
LLSDDGSEGLTLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLA
RDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMM
VDSTFYNKIKSGYRMAKPDHATREIYEIMVKCWNSEPEKRPSFYHLREIVENLLPGQYKK
SYEKIHLDFLKSDHPAVARMRVDADNAYIGVTYKNEEDKLKDWEGGLDEQRLSADSGYII
PLPDIDPVPEEEDLGKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDIDMMDDIGIDS
SDLVEDSFL
NT seq 3270 nt   +upstreamnt  +downstreamnt
atggggacttcccatctggcactcctggtcttaggctgtctccttgcagggccgagccta
attttctgccagctttcattgccctccatcctcccaaatgaaaatgaaaaggttgtgcag
ctgaattcatccttttctctgagatgcttgggggagagtgaagtatcctggctgtacccc
atatctgaggacaagaaggccaatgtgaccatcagaagtgaggagaacaacagtggcctt
tttgtgaaagtgctcgaagtggccagtgcctcggcggctcacacggggttgtacacttgc
tattacaaccacacgcagacagaagaaagcgaggtcgaaggcagtcacatctacatctac
gtgccagacccggatgtagccttcgtacccctaggaatgacagattatttagtcatcgtg
gagaacgatgattttgccatcataccttgtcgcacgactgatcctcagacgccggtaacc
ttactcagcagggacggggtggtcctggccgcctatgacagcagacagggctttaacgga
agcttcactggtgggccctacatctgcgaggccatcgtcagagggaagaagttccagacc
attccatttaacatttatgcattaaaagcaacgtcagaacttgacctagaattggaagct
cctaaaactgtgtacaagtcaggggaaaccatcgcgctcacctgcatcgtcttcaacaac
gaggtggtggacttccagtggacttaccctggagaagtgaagagcaaaggcgtcgtaatg
ctggaggaaatcaaggacccatccctcaaactggtgtacacgctgatggtccccaaggcc
acggtgaaagacagtggagattacgaatgtgttgcccgccaggccaccagcgaggtcaaa
gaaatgaagaaggtcaccatttctgtccatgagaaagggttcattgaaatccagccctac
ttcagccagttggaagccgtcaacctgcacgaagtcaagcactttgtggtggacgtgcag
gcctacccccctcccaggatatcctggctcaaggacaacctgactctgattgaaaacctc
acggagatcaccaccgacattgaaaagattcaggaaataaggtatcgaagcaaattaaag
ctgatccgtgctaaggaagaggacagcggccactacactattgtagttcaaaatgaggat
gacatgaagagctacacctttgaactcttaactcaagtcccctcgtcaattctggatttg
gtcgatgaccaccacggatctacgggggcacagaccgtgagatgcacagctgcagggacg
ccgcttcctgatattgagtggatgatttgcaaggatattaagaaatgtaataatgagact
tcgtggacaattttggccagcaacatctcaaacatcatcacggaggtccaccccctggac
aggagtgtggtggagggccaggtgacattcgccaaagtggaggagaccatcgccgtccgg
tgtctggctaagaatctccttggggcagataaccgagagctgaagctggtggctcccact
ctgcgttctgaactcacggtggcagctgcagtcctggtgctattggtgattgtgatcatc
tcactgatcgtcctggttgtcatttggaaacagaaaccgaggtatgaaattcgctggagg
gtcattgaatcaatcagccccgatggacatgaatacatttatgtggacccaatgcagttg
ccttatgactcgaggtgggagtttcccagagacggactagtgttgggtcgtatactggga
tctggtgcttttgggaaagtggttgaagggactgcctatggattaagccggtcccagcct
gtcatgaaagtagcagtgaagatgcttaaacccacagccagatccagtgagaaacaagct
ctcatgtctgaactgaagataatgacccacctggggccacatttaaatattgtaaacttg
ctgggagcctgtaccaagtcaggccccatttacatcatcaccgagtactgcttctatggg
gacttggtcaactatttgcataagaacagggacagcttcctgagccaccacccagagaag
ccaaagaaagagctggacatctttggattgaaccccactgatgaaagcactcggagttat
gtcgttttatctttcgagaacaacggtgactacatggacatgaagcaagctgacaccacc
cagtatgtccccatgctggaaaggaaagaggtttctaaatattcggacatccagagatcg
ctgtatgaccgcccagcctcgtataagaagaaatctatgttagagtcagaagtcaaaaac
ctcctttctgatgatggctcggaaggccttactttgttggatttgctgagcttcacctac
caagttgcccgaggaatggaatttttggcttcaaaaaattgtgtccaccgggacctggct
gctcgcaacgtcctcctggcccaagggaaaatcgtaaagatctgtgactttggcctagcc
agggacatcatgcatgattcgaactatgtatcgaaaggcagcaccttcctccccgtgaag
tggatggctcctgagagcatcttcgacaacctctacaccacgctgagcgacgtctggtct
tacggcattctgctctgggagatcttttcccttgggggcacaccctaccctggcatgatg
gtggattctactttctacaataagatcaagagtgggtaccggatggccaagcctgaccac
gccaccagggaaatctacgagatcatggtcaagtgctggaacagtgagcccgagaagaga
ccgtccttttaccacctgagagagattgtggagaacctgttgcctggacaatataaaaag
agttatgagaagattcacctggatttcctgaagagcgaccatcccgctgtggcacgcatg
cgagtggatgctgacaacgcctacattggcgtcacctacaaaaatgaggaagacaaactg
aaggactgggagggtggcctggacgagcagaggctgagtgctgacagtggctacatcatc
cctctgcctgacatcgatcctgttcctgaggaggaagacctgggcaagaggaacagacac
agctcacagacctctgaagagagtgccattgagacaggttccagcagctctacgttcatc
aagagagaggatgagaccattgaggacatcgacatgatggatgacattggcatagactcc
tcagacctggtggaggacagcttcctttaa

DBGET integrated database retrieval system