KEGG   Desmodus rotundus (common vampire bat): 112317202
Entry
112317202         CDS       T05907                                 

Gene name
RELA
Definition
(RefSeq) transcription factor p65
  KO
K04735  transcription factor p65
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro01523  Antifolate resistance
dro04010  MAPK signaling pathway
dro04014  Ras signaling pathway
dro04024  cAMP signaling pathway
dro04062  Chemokine signaling pathway
dro04064  NF-kappa B signaling pathway
dro04066  HIF-1 signaling pathway
dro04071  Sphingolipid signaling pathway
dro04137  Mitophagy - animal
dro04151  PI3K-Akt signaling pathway
dro04210  Apoptosis
dro04211  Longevity regulating pathway
dro04218  Cellular senescence
dro04380  Osteoclast differentiation
dro04620  Toll-like receptor signaling pathway
dro04621  NOD-like receptor signaling pathway
dro04622  RIG-I-like receptor signaling pathway
dro04623  Cytosolic DNA-sensing pathway
dro04625  C-type lectin receptor signaling pathway
dro04657  IL-17 signaling pathway
dro04658  Th1 and Th2 cell differentiation
dro04659  Th17 cell differentiation
dro04660  T cell receptor signaling pathway
dro04662  B cell receptor signaling pathway
dro04668  TNF signaling pathway
dro04722  Neurotrophin signaling pathway
dro04917  Prolactin signaling pathway
dro04920  Adipocytokine signaling pathway
dro04926  Relaxin signaling pathway
dro04931  Insulin resistance
dro04932  Non-alcoholic fatty liver disease
dro04933  AGE-RAGE signaling pathway in diabetic complications
dro05010  Alzheimer disease
dro05022  Pathways of neurodegeneration - multiple diseases
dro05030  Cocaine addiction
dro05132  Salmonella infection
dro05133  Pertussis
dro05134  Legionellosis
dro05135  Yersinia infection
dro05140  Leishmaniasis
dro05142  Chagas disease
dro05145  Toxoplasmosis
dro05146  Amoebiasis
dro05152  Tuberculosis
dro05160  Hepatitis C
dro05161  Hepatitis B
dro05162  Measles
dro05163  Human cytomegalovirus infection
dro05164  Influenza A
dro05165  Human papillomavirus infection
dro05166  Human T-cell leukemia virus 1 infection
dro05167  Kaposi sarcoma-associated herpesvirus infection
dro05168  Herpes simplex virus 1 infection
dro05169  Epstein-Barr virus infection
dro05170  Human immunodeficiency virus 1 infection
dro05200  Pathways in cancer
dro05202  Transcriptional misregulation in cancer
dro05203  Viral carcinogenesis
dro05212  Pancreatic cancer
dro05215  Prostate cancer
dro05220  Chronic myeloid leukemia
dro05221  Acute myeloid leukemia
dro05222  Small cell lung cancer
dro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
dro05321  Inflammatory bowel disease
dro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112317202 (RELA)
   04014 Ras signaling pathway
    112317202 (RELA)
   04064 NF-kappa B signaling pathway
    112317202 (RELA)
   04668 TNF signaling pathway
    112317202 (RELA)
   04066 HIF-1 signaling pathway
    112317202 (RELA)
   04071 Sphingolipid signaling pathway
    112317202 (RELA)
   04024 cAMP signaling pathway
    112317202 (RELA)
   04151 PI3K-Akt signaling pathway
    112317202 (RELA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    112317202 (RELA)
  09143 Cell growth and death
   04210 Apoptosis
    112317202 (RELA)
   04218 Cellular senescence
    112317202 (RELA)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    112317202 (RELA)
   04621 NOD-like receptor signaling pathway
    112317202 (RELA)
   04622 RIG-I-like receptor signaling pathway
    112317202 (RELA)
   04623 Cytosolic DNA-sensing pathway
    112317202 (RELA)
   04625 C-type lectin receptor signaling pathway
    112317202 (RELA)
   04660 T cell receptor signaling pathway
    112317202 (RELA)
   04658 Th1 and Th2 cell differentiation
    112317202 (RELA)
   04659 Th17 cell differentiation
    112317202 (RELA)
   04657 IL-17 signaling pathway
    112317202 (RELA)
   04662 B cell receptor signaling pathway
    112317202 (RELA)
   04062 Chemokine signaling pathway
    112317202 (RELA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    112317202 (RELA)
   04917 Prolactin signaling pathway
    112317202 (RELA)
   04926 Relaxin signaling pathway
    112317202 (RELA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    112317202 (RELA)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    112317202 (RELA)
  09149 Aging
   04211 Longevity regulating pathway
    112317202 (RELA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112317202 (RELA)
   05202 Transcriptional misregulation in cancer
    112317202 (RELA)
   05203 Viral carcinogenesis
    112317202 (RELA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    112317202 (RELA)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    112317202 (RELA)
   05221 Acute myeloid leukemia
    112317202 (RELA)
   05220 Chronic myeloid leukemia
    112317202 (RELA)
   05215 Prostate cancer
    112317202 (RELA)
   05222 Small cell lung cancer
    112317202 (RELA)
  09163 Immune disease
   05321 Inflammatory bowel disease
    112317202 (RELA)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112317202 (RELA)
   05022 Pathways of neurodegeneration - multiple diseases
    112317202 (RELA)
  09165 Substance dependence
   05030 Cocaine addiction
    112317202 (RELA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    112317202 (RELA)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    112317202 (RELA)
   04931 Insulin resistance
    112317202 (RELA)
   04933 AGE-RAGE signaling pathway in diabetic complications
    112317202 (RELA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112317202 (RELA)
   05135 Yersinia infection
    112317202 (RELA)
   05133 Pertussis
    112317202 (RELA)
   05134 Legionellosis
    112317202 (RELA)
   05152 Tuberculosis
    112317202 (RELA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112317202 (RELA)
   05170 Human immunodeficiency virus 1 infection
    112317202 (RELA)
   05162 Measles
    112317202 (RELA)
   05164 Influenza A
    112317202 (RELA)
   05161 Hepatitis B
    112317202 (RELA)
   05160 Hepatitis C
    112317202 (RELA)
   05168 Herpes simplex virus 1 infection
    112317202 (RELA)
   05163 Human cytomegalovirus infection
    112317202 (RELA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    112317202 (RELA)
   05169 Epstein-Barr virus infection
    112317202 (RELA)
   05165 Human papillomavirus infection
    112317202 (RELA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    112317202 (RELA)
   05145 Toxoplasmosis
    112317202 (RELA)
   05140 Leishmaniasis
    112317202 (RELA)
   05142 Chagas disease
    112317202 (RELA)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    112317202 (RELA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dro03000]
    112317202 (RELA)
Transcription factors [BR:dro03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    112317202 (RELA)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer
Other DBs
NCBI-GeneID: 112317202
NCBI-ProteinID: XP_024430030
LinkDB
Position
Unknown
AA seq 551 aa
PLSDLFPLIFPSEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHP
TIKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGYYEAELCPDRCIHSFQNLGIQ
CVKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLSPVL
SHPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSF
SQADVHRQVAIVFRTPPYADSSLQAPVRVSMHLRRPSDRELSEPMEFQYLPDTDDRHRIE
EKRKRTYETFKSIMKKSPFNGPTDPRPPPRRIAVPSRSSTSIPKPAPQPYPFTPSLSTIN
FEEFSPMVFSGQIPSQTSALAPAPAPILAQAPAPAPSMASTLVQASAPVPVLASGLAQAM
APPVPKPTQAGEGTLTEALLQLQFDADEDLGSLLGNSTDPAVFTDLASVDNSEFQQLLNQ
GVPMAPHTAEPMLMEYPEAITRLVTGSQRPPDPAPIPLGASGLPNGLLSGDEDFTSIADM
DLSALLSQISS
NT seq 1656 nt   +upstreamnt  +downstreamnt
cctctttcagacctgtttcccctcatcttcccctccgagccagcccaggcctccggcccg
tacgtggagatcatcgagcagcccaaacagcggggcatgcgcttccgctacaagtgcgag
ggccgctcagcgggcagcattccaggcgagaggagcacagataccaccaagacccaccct
accattaagatcaatggctacacggggccagggacagttcgcatctccctggtcaccaag
gacccccctcaccggcctcacccccacgagctcgtagggaaagactgccgggatggctac
tacgaggctgagctctgcccggaccgctgcatccacagcttccagaacctggggatccag
tgtgtgaagaagcgggacctggagcaggccattagtcagcgcatacagaccaacaacaac
cccttccaagtccccatagaggagcaacgcggagactacgacttgaatgcggtgcggctc
tgcttccaggtgacagtgcgggacccgtcaggcaggcccctccgcctgtcacctgtcctc
tctcatcccatctttgacaaccgcgcccccaacaccgcagagctcaagatctgccgggtg
aaccgaaactctgggagctgccttggtggggatgagatcttcctgctgtgtgacaaagta
cagaaagaggacattgaagtgtatttcactggaccaggctgggaggcccgaggctccttt
tcgcaagccgatgtgcaccgacaagtggccatcgtgttccggacacctccctacgctgac
tccagcctgcaggcccccgtgcgcgtctctatgcacctgcggcggccttcagatcgggag
ctcagcgagcccatggaattccagtacttgccagacacagatgatcgtcaccggattgag
gagaaacgcaaaaggacctatgagacctttaagagcatcatgaagaagagtcctttcaat
ggacccactgacccccgacctcctccccggcgcattgctgtgccttcccgcagctcgacg
tccatccccaagccagctccccagccctatccctttacgccgtccctcagcactatcaac
tttgaggagttttcccccatggtcttctccgggcagatcccaagccagacctctgccttg
gcaccagcccctgcccccatcctggctcaggccccagcccctgctccatccatggcatca
accctggttcaggcctcagcccctgtcccagtcctagcctccggccttgctcaggctatg
gccccacctgtccccaagcccacccaggcaggggaagggacactgacagaggcactgcta
cagctgcagtttgatgctgatgaagacctggggtccctgctgggcaatagcacagaccca
gccgtgttcacggacctggcatccgttgacaactccgagtttcagcagctgctgaaccag
ggtgtacctatggccccccacacagcagagcctatgttgatggagtaccctgaggccata
acacgcctggtgacagggtcccagcggccccctgacccagctcccattcccctgggggcc
tctgggctccccaacggcctcctctcaggggatgaagacttcacctccatcgcagacatg
gacttgtcagcccttctgagtcagatcagctcctaa

DBGET integrated database retrieval system