KEGG   Desmodus rotundus (common vampire bat): 112317701
Entry
112317701         CDS       T05907                                 

Gene name
ITGB1
Definition
(RefSeq) integrin beta-1
  KO
K05719  integrin beta 1
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04015  Rap1 signaling pathway
dro04145  Phagosome
dro04151  PI3K-Akt signaling pathway
dro04360  Axon guidance
dro04510  Focal adhesion
dro04512  ECM-receptor interaction
dro04514  Cell adhesion molecules
dro04530  Tight junction
dro04611  Platelet activation
dro04670  Leukocyte transendothelial migration
dro04810  Regulation of actin cytoskeleton
dro05100  Bacterial invasion of epithelial cells
dro05133  Pertussis
dro05135  Yersinia infection
dro05140  Leishmaniasis
dro05145  Toxoplasmosis
dro05165  Human papillomavirus infection
dro05200  Pathways in cancer
dro05205  Proteoglycans in cancer
dro05222  Small cell lung cancer
dro05410  Hypertrophic cardiomyopathy
dro05412  Arrhythmogenic right ventricular cardiomyopathy
dro05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    112317701 (ITGB1)
   04151 PI3K-Akt signaling pathway
    112317701 (ITGB1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112317701 (ITGB1)
   04514 Cell adhesion molecules
    112317701 (ITGB1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    112317701 (ITGB1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112317701 (ITGB1)
   04530 Tight junction
    112317701 (ITGB1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112317701 (ITGB1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    112317701 (ITGB1)
   04670 Leukocyte transendothelial migration
    112317701 (ITGB1)
  09158 Development and regeneration
   04360 Axon guidance
    112317701 (ITGB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112317701 (ITGB1)
   05205 Proteoglycans in cancer
    112317701 (ITGB1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    112317701 (ITGB1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    112317701 (ITGB1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    112317701 (ITGB1)
   05414 Dilated cardiomyopathy
    112317701 (ITGB1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    112317701 (ITGB1)
   05133 Pertussis
    112317701 (ITGB1)
   05100 Bacterial invasion of epithelial cells
    112317701 (ITGB1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112317701 (ITGB1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    112317701 (ITGB1)
   05140 Leishmaniasis
    112317701 (ITGB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dro04131]
    112317701 (ITGB1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dro04147]
    112317701 (ITGB1)
   04515 Cell adhesion molecules [BR:dro04515]
    112317701 (ITGB1)
   04090 CD molecules [BR:dro04090]
    112317701 (ITGB1)
Membrane trafficking [BR:dro04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    112317701 (ITGB1)
Exosome [BR:dro04147]
 Exosomal proteins
  Proteins found in most exosomes
   112317701 (ITGB1)
Cell adhesion molecules [BR:dro04515]
 Integrins
  Integrin beta subunits
   112317701 (ITGB1)
CD molecules [BR:dro04090]
 Proteins
  112317701 (ITGB1)
SSDB
Motif
Pfam: Integrin_beta Integrin_b_cyt Integrin_B_tail I-EGF_1 PSI_integrin EGF_2
Other DBs
NCBI-GeneID: 112317701
NCBI-ProteinID: XP_024430543
LinkDB
Position
Unknown
AA seq 798 aa
MNLQLIFWIKLVSSICYVFGQADENRCLKANAKSCGECIQAGPNCGWCTNSTFLQEGMPT
SARCDDLEALKKKGCHPDDIENPRGSKDIKKNKNVTNRSKGTVEKLQPEDITQIQPQQLV
LQLRSGEPQTFALKFKRAEDYPIDLYYLMDLSYSMKDDLENVKSLGTDLMNEMKRITSDF
RIGFGSFVEKTVMPYISTTPAKLRNPCTGDQNCTSPFSYKNVLSLTDKGEVFNELVGKQR
ISGNLDSPEGGFDAIMQVAVCGSLIGWRNVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGQ
CHLENNVYTMSHYYDYPSIAHLVQKLSENNIQTIFAVTEEFQPVYKELKNLIPKSAVGTL
SANSSNVIQLIIDAYNSLSSEVILENSKLPEGVTINYKSYCKNGVNGTGENGRKCSNISI
GDEVQFEISITSNKCPNKNSETIKIKPLGFTEEVEIILQFICECECQSEGIPGSPKCHEG
NGTFECGACRCNEGRVGRHCECSTDEVNSEDMDAYCRKENSSEICSNNGECVCGQCVCRK
RDNTNEIYSGKFCECDNFNCDRSNGLICGGNGVCKCRVCECNPNYTGSACDCSLDTTSCM
ATNGQICNGRGVCECGACKCTDPKFQGPTCEMCQTCLGVCAEHKECVQCRAFNKGEKKDI
CAQECSHFNITKVESRDKLPQPGQVDPLSHCKEKDVDDCWFYFTYSVNGNNEAIVHVVET
PECPTGPDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWDTGEN
PIYKSAVTTVVNPKYEGK
NT seq 2397 nt   +upstreamnt  +downstreamnt
atgaatttacaactgattttctggattaaactggtcagttcaatttgctatgtgtttggc
caagcagatgaaaatagatgtctaaaagcaaatgccaaatcatgtggagaatgtatacaa
gcagggccaaattgtggatggtgtacaaattcaacatttttacaagaaggaatgcctact
tctgcacgatgtgatgatttagaagccttaaaaaagaaggggtgtcatccagatgacata
gaaaatccaagaggttccaaagatataaagaaaaataaaaatgtaaccaaccgtagcaaa
ggaacagtagagaagctccagccagaagatatcacacagatccaaccacagcagttggtt
ttgcagttacgatcaggggagccacagacatttgcattaaaattcaagagagctgaagac
tatcccattgatctctactacttaatggacctctcctactctatgaaagatgatttggag
aatgtaaaaagtcttggaacggatctgatgaatgaaatgaagaggattacttcagacttc
aggatagggtttggctcatttgtggagaagactgtaatgccttatattagtacaacacct
gccaagctcaggaacccttgcacaggtgatcagaactgcaccagcccatttagctacaaa
aatgttctcagtcttactgataaaggggaggtatttaacgaacttgttggaaaacaacgc
atatctggaaatttggattctccagaaggtggctttgatgcaattatgcaagttgcagtt
tgtgggtcattgattggctggaggaatgttacacggctgctggtgttttctacagacgcg
gggtttcactttgctggagatgggaaacttggtggcattgttttaccaaatgatggacag
tgtcacctggaaaataatgtatacacaatgagccattattatgattatccttctattgct
caccttgtccagaaactaagtgaaaataacattcagacgatttttgcagttactgaagaa
tttcagcccgtttacaaggaactgaaaaatttgatccctaagtcagcagtaggaacatta
tctgcaaattctagcaatgtaattcaattgatcattgatgcatacaattccctttcctca
gaagtaattttggaaaacagcaaattgccagaaggagtaacaataaattataaatcttac
tgtaagaatggggtgaatggaacaggggaaaatggaagaaaatgctccaatatttccatt
ggagatgaggttcaatttgaaattagcataacttcaaataaatgtccaaataagaattct
gaaaccattaaaattaagcctctgggcttcactgaagaagtagagattattcttcagttc
atctgtgagtgtgagtgccaaagtgaaggcatccctggcagtccaaagtgtcacgaaggg
aatggaacgtttgagtgtggcgcgtgcaggtgcaatgaggggcgcgttggcagacactgt
gaatgcagcacagatgaagtgaacagcgaagacatggatgcgtactgcaggaaagaaaac
agctccgagatctgcagcaacaatggagagtgtgtctgtgggcagtgtgtttgtaggaag
agggataatacaaatgaaatttattctggcaaattctgcgagtgtgataatttcaactgt
gatagatccaacggcttaatttgtggaggaaatggtgtttgcaaatgccgtgtgtgtgaa
tgtaaccccaactacacaggcagtgcgtgtgactgctctctggacacaacgtcatgcatg
gccacaaacggacagatctgcaatggccgaggcgtatgtgagtgcggcgcctgcaagtgc
acagatcccaagtttcaggggccaacttgtgagatgtgtcagacctgcctcggtgtctgt
gctgaacataaagaatgtgttcagtgcagagccttcaataaaggagaaaagaaagacata
tgtgcacaggaatgttcccattttaacattaccaaagttgaaagtcgggacaaattaccc
caaccagggcaggtcgatcccctgtcccactgcaaggagaaggatgttgatgattgctgg
ttctatttcacatattcagtgaatgggaacaatgaggccattgtacacgttgtagagacc
ccagagtgccccactggtccagacatcattccaattgtagctggtgtggtggctggaatt
gttctgattggccttgcattgctgctgatttggaagcttttgatgataattcatgaccga
agggaatttgccaaatttgaaaaggaaaaaatgaatgccaaatgggacacgggtgaaaat
cctatttataagagtgctgtgacaactgttgtcaatccgaagtatgagggaaaatga

DBGET integrated database retrieval system