KEGG   Desmodus rotundus (common vampire bat): 112318067
Entry
112318067         CDS       T05907                                 

Gene name
FGF1
Definition
(RefSeq) fibroblast growth factor 1
  KO
K18496  fibroblast growth factor 1
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04010  MAPK signaling pathway
dro04014  Ras signaling pathway
dro04015  Rap1 signaling pathway
dro04151  PI3K-Akt signaling pathway
dro04390  Hippo signaling pathway
dro04810  Regulation of actin cytoskeleton
dro05200  Pathways in cancer
dro05218  Melanoma
dro05224  Breast cancer
dro05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112318067 (FGF1)
   04014 Ras signaling pathway
    112318067 (FGF1)
   04015 Rap1 signaling pathway
    112318067 (FGF1)
   04390 Hippo signaling pathway
    112318067 (FGF1)
   04151 PI3K-Akt signaling pathway
    112318067 (FGF1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112318067 (FGF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112318067 (FGF1)
  09162 Cancer: specific types
   05226 Gastric cancer
    112318067 (FGF1)
   05218 Melanoma
    112318067 (FGF1)
   05224 Breast cancer
    112318067 (FGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:dro04052]
    112318067 (FGF1)
   00536 Glycosaminoglycan binding proteins [BR:dro00536]
    112318067 (FGF1)
Cytokines and growth factors [BR:dro04052]
 Growth factors
  Growth factors (RTK binding)
   112318067 (FGF1)
Glycosaminoglycan binding proteins [BR:dro00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   112318067 (FGF1)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 112318067
NCBI-ProteinID: XP_024430875
LinkDB
Position
Unknown
AA seq 155 aa
MAEGEVTTFTALTEKFNLPLESYKKPKLLYCSNGGHFLRILPDGTVDGTRDKSDQHIQLQ
LSAESVGEVYIKSTGSGQYLAMDSAGLLYGSQTPNEECLFLERLEENHYNTYTSKKHAEK
NWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVNSD
NT seq 468 nt   +upstreamnt  +downstreamnt
atggctgaaggggaagtcaccacgttcacagctctgactgagaagtttaatctgcctctg
gagagttacaagaagcccaaacttctctactgcagcaacggtggccacttcctgaggatc
cttccagatggtacagtggatgggacaagggacaagagcgaccagcacattcagctgcag
ctcagtgcggaaagcgtgggggaggtgtacataaagagcaccgggagtggccagtacttg
gccatggactccgccgggcttttgtatggctcacagacaccaaatgaggaatgtttgttc
ctggaaaggctggaggaaaaccattacaacacctacacatccaagaagcatgcagaaaag
aattggttcgtggggctcaagaagaatggaagctgcaagcgtggcccccggactcattat
ggccagaaagcaatcttgtttctccccctgccagtcaactctgattaa

DBGET integrated database retrieval system