KEGG   Desmodus rotundus (common vampire bat): 112318130
Entry
112318130         CDS       T05907                                 

Gene name
NR3C1
Definition
(RefSeq) glucocorticoid receptor isoform X1
  KO
K05771  glucocorticoid receptor
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    112318130 (NR3C1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dro03000]
    112318130 (NR3C1)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:dro03310]
    112318130 (NR3C1)
Transcription factors [BR:dro03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    112318130 (NR3C1)
Nuclear receptors [BR:dro03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   112318130 (NR3C1)
SSDB
Motif
Pfam: GCR zf-C4 Hormone_recep MyTH4
Other DBs
NCBI-GeneID: 112318130
NCBI-ProteinID: XP_024430985
LinkDB
Position
Unknown
AA seq 791 aa
MPLKTPRWYSLMDPKESLSSASREETPSSSVLVPERGNVMDFYKTLRGGAIVNVSTSSSS
LAAVSQSDSKQQRLVVDFPKGSGSNAQQPDLSKAVSLSMGLYMGETDTKVMGNDLGFPQQ
GQISLSSGETDLQLLEESIANLNKSTSVPENPTSSASAAISAAPTEQEFPKTSSDVSSEP
QNSKSETGTNTGNVKLYTTDQRTFDILQDLEFSSGSPGKEMNESPWRPDLLIDENCLLSP
LTGEDDPFLLEGNMNEDYKPLVLPDTKPNIKDNGDLILSSPTTSVTLPQVKTEKDDFIEL
CTPGVIKQEKLGPVYCQTSFSGANIIGNKMSAISIHGVSTSGGQMYHYDMNTASLSQQQD
QKPVFNVIPPIPIGSENWNRCQGSGDDNLTSLGTLNFPGQSVFSNGYSSPGMRPDVSSPP
STSSAAAGPPPKLCLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDK
IRRKNCPACRYRKCLQAGMNLEARKTKKKIKGIQQAAPGVAQETPENPANKTVVPAALPQ
VSPTLVSLLEVIEPEVLFAGYDSSLPDSTWRIMTTLNMLGGRQVIAAVKWAKALPGFRNL
HLDDQMTLLQYSWMFLMSFALGWRSYKQSSHGNMLCFAPDLIINKERMALPFLFEQCKHM
LFVSSELERLEVSYEEYLCMKTLLLLSSVPKEGLKSQELFDEIRMTYIKELGKAIVQREG
SSSQNWQRFYQLTKLLDCMHDVAENLLHYCFQTFLDKTMSIEFPEMLAEIISNQLPKYSS
GNVKKLLFHQK
NT seq 2376 nt   +upstreamnt  +downstreamnt
atgccacttaagaccccacgctggtattcattgatggaccccaaggaatcattaagctca
gccagcagagaagaaacccccagcagcagtgtgcttgttccggagaggggaaatgtgatg
gacttctataaaaccctgaggggaggagctattgtgaacgtttctacatcttcgtcctca
ctggctgctgtttctcagtcagactccaagcagcaacgacttgtggttgattttccaaaa
ggctcgggaagcaatgcgcagcagccagatctgtccaaggcagtttcactctcaatggga
ctgtatatgggagagacagacacaaaagtgatgggtaatgatctgggattcccacagcag
ggccaaataagcctttcctctggggaaacagacttacagcttctggaagaaagcattgca
aaccttaataagtcgaccagtgttccagagaaccccacgagttcagcatccgctgctatt
tctgctgcccccacagagcaggagtttccgaaaacaagctctgatgtgtcttcagaaccg
cagaattcgaagagcgagactggcaccaacacaggcaatgtgaagttgtataccacagac
caaagaacctttgacattttgcaggatttggagttctcttctgggtccccaggtaaagag
atgaatgagagcccttggagaccagacctcttgatagatgaaaactgtttgctttctcct
ttgacaggagaggatgatccattccttttggaaggaaacatgaatgaggactataagcct
ctcgttttaccggacactaaacctaacattaaggataatggagatctgatcttatcaagc
cccaccaccagtgtgacactgccccaagtgaaaaccgaaaaagatgacttcatcgaactc
tgcacccccggagtaattaagcaggagaaactgggcccagtttactgtcaaacaagcttt
tctggggcaaatataattggtaataaaatgtctgccatttctattcacggcgtgagtacc
tcagggggacagatgtaccactatgacatgaatacagcatccctttctcaacagcaggat
cagaagcctgtttttaatgtcattccaccaatccctattggttcagaaaattggaatagg
tgccaaggatctggagatgacaacttgacttccttggggactttgaacttccctggccaa
tcagtcttttctaatggctattcaagccctgggatgagaccagatgtgagctctcctcca
tccacctcctcagcagcagcgggaccacctcccaaactctgcctggtgtgctctgatgaa
gcctcaggatgtcattacggggtcttgacttgtggaagctgtaaagtcttcttcaaaaga
gcagtggaaggacagcataattatctttgtgctggaagaaatgattgcatcattgataaa
attcgaagaaagaactgcccagcatgccgctatcgaaaatgtctccaagctggaatgaac
ctggaagctagaaaaacaaagaaaaagatcaaaggaattcagcaggcagctccaggtgtc
gcacaagaaactcctgaaaatcctgctaacaaaacagtagtccctgcagcgctgccacaa
gtcagccctaccctggtgtcgctgttggaggtcatcgagcccgaggtgttgtttgcaggg
tacgatagctctcttccagattccacttggcggatcatgaccacactcaacatgttaggc
ggacggcaagtgattgcagcagtgaaatgggcaaaggcattaccaggattcaggaactta
cacctggatgaccaaatgaccttgctgcagtactcatggatgttcctcatgtcgtttgcc
ctgggatggagatcatacaaacaatcatcacatgggaacatgctgtgttttgctcctgat
ctgattattaacaaggagaggatggctctacccttcctgtttgaacaatgtaaacatatg
ctattcgtttcctctgagttagagaggcttgaggtatcttacgaagagtatctctgtatg
aagaccttactgcttctctcatcagttcctaaggaagggttgaagagccaagagctgttt
gatgaaatcaggatgacctacatcaaagagctggggaaagccattgtccagagggaaggc
agctccagccagaactggcagcggttctaccagctgacaaaactcttggactgcatgcat
gacgtagctgaaaatctccttcactattgcttccaaacatttttggataagaccatgagt
attgaattcccagagatgttagctgaaatcatctccaatcagttaccaaaatattcaagt
ggaaatgtcaaaaaacttctgtttcatcaaaagtga

DBGET integrated database retrieval system