KEGG   Desmodus rotundus (common vampire bat): 112318159
Entry
112318159         CDS       T05907                                 

Gene name
IL4
Definition
(RefSeq) interleukin-4
  KO
K05430  interleukin 4
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04060  Cytokine-cytokine receptor interaction
dro04151  PI3K-Akt signaling pathway
dro04630  JAK-STAT signaling pathway
dro04640  Hematopoietic cell lineage
dro04657  IL-17 signaling pathway
dro04658  Th1 and Th2 cell differentiation
dro04659  Th17 cell differentiation
dro04660  T cell receptor signaling pathway
dro04664  Fc epsilon RI signaling pathway
dro04672  Intestinal immune network for IgA production
dro05140  Leishmaniasis
dro05200  Pathways in cancer
dro05310  Asthma
dro05320  Autoimmune thyroid disease
dro05321  Inflammatory bowel disease
dro05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    112318159 (IL4)
   04151 PI3K-Akt signaling pathway
    112318159 (IL4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    112318159 (IL4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    112318159 (IL4)
   04660 T cell receptor signaling pathway
    112318159 (IL4)
   04658 Th1 and Th2 cell differentiation
    112318159 (IL4)
   04659 Th17 cell differentiation
    112318159 (IL4)
   04657 IL-17 signaling pathway
    112318159 (IL4)
   04664 Fc epsilon RI signaling pathway
    112318159 (IL4)
   04672 Intestinal immune network for IgA production
    112318159 (IL4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112318159 (IL4)
  09163 Immune disease
   05310 Asthma
    112318159 (IL4)
   05320 Autoimmune thyroid disease
    112318159 (IL4)
   05321 Inflammatory bowel disease
    112318159 (IL4)
   05330 Allograft rejection
    112318159 (IL4)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    112318159 (IL4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:dro04052]
    112318159 (IL4)
   00536 Glycosaminoglycan binding proteins [BR:dro00536]
    112318159 (IL4)
Cytokines and growth factors [BR:dro04052]
 Cytokines
  Interleukins
   112318159 (IL4)
Glycosaminoglycan binding proteins [BR:dro00536]
 Heparan sulfate / Haparin
  Cytokines
   112318159 (IL4)
SSDB
Motif
Pfam: IL4
Other DBs
NCBI-GeneID: 112318159
NCBI-ProteinID: XP_024431039
LinkDB
Position
Unknown
AA seq 137 aa
MGLPSHLIPALVCLLACSSNFIHGRQGNITLEETIKTLNILTTKNDPQCMELLVADVLTA
PKNATERETFCRAVAVLRQVYRNHHECETRKFLFRLDRNLNSMASKAVCPVSEVRKSTLK
DFLERLRRIMQEKYARG
NT seq 414 nt   +upstreamnt  +downstreamnt
atgggtctcccctcccacctgatcccagccctggtctgcttactagcatgcagcagcaac
ttcatccacggacgccagggcaacatcaccttagaagagaccatcaagacgctgaacatc
ctcacaacgaaaaacgatccacagtgcatggagctgctcgtagccgacgtcttgacggcc
cccaagaacgcaaccgagagggagaccttctgcagggccgtggcggtgctgcggcaggtg
tacaggaaccaccacgagtgtgagaccaggaagttcctgttcaggctcgacaggaacctc
aacagcatggccagcaaggccgtgtgtcccgtgagcgaagtcaggaagagcacactgaaa
gacttcctggaaagactgaggaggatcatgcaagagaaatacgcaaggggttga

DBGET integrated database retrieval system