KEGG   Desmodus rotundus (common vampire bat): 112318485
Entry
112318485         CDS       T05907                                 

Gene name
CDKN1B
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro01522  Endocrine resistance
dro04012  ErbB signaling pathway
dro04066  HIF-1 signaling pathway
dro04068  FoxO signaling pathway
dro04110  Cell cycle
dro04151  PI3K-Akt signaling pathway
dro04933  AGE-RAGE signaling pathway in diabetic complications
dro04934  Cushing syndrome
dro05162  Measles
dro05165  Human papillomavirus infection
dro05169  Epstein-Barr virus infection
dro05200  Pathways in cancer
dro05202  Transcriptional misregulation in cancer
dro05203  Viral carcinogenesis
dro05206  MicroRNAs in cancer
dro05215  Prostate cancer
dro05220  Chronic myeloid leukemia
dro05222  Small cell lung cancer
dro05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    112318485 (CDKN1B)
   04066 HIF-1 signaling pathway
    112318485 (CDKN1B)
   04068 FoxO signaling pathway
    112318485 (CDKN1B)
   04151 PI3K-Akt signaling pathway
    112318485 (CDKN1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112318485 (CDKN1B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112318485 (CDKN1B)
   05202 Transcriptional misregulation in cancer
    112318485 (CDKN1B)
   05206 MicroRNAs in cancer
    112318485 (CDKN1B)
   05203 Viral carcinogenesis
    112318485 (CDKN1B)
  09162 Cancer: specific types
   05226 Gastric cancer
    112318485 (CDKN1B)
   05220 Chronic myeloid leukemia
    112318485 (CDKN1B)
   05215 Prostate cancer
    112318485 (CDKN1B)
   05222 Small cell lung cancer
    112318485 (CDKN1B)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    112318485 (CDKN1B)
   04934 Cushing syndrome
    112318485 (CDKN1B)
  09172 Infectious disease: viral
   05162 Measles
    112318485 (CDKN1B)
   05169 Epstein-Barr virus infection
    112318485 (CDKN1B)
   05165 Human papillomavirus infection
    112318485 (CDKN1B)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    112318485 (CDKN1B)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 112318485
NCBI-ProteinID: XP_024431519
LinkDB
Position
Unknown
AA seq 198 aa
MSNVRVSNGSPSLERMDARQAEYPKPSACRNLFGPVNHEELTRDLEKHCRDMEEASQRKW
NFDFQNHRPLEGKYEWQEVEKGSLPEFYYRPPRPPKGACKVPAQESQDVRGNRQSGPLIG
SQANSEDTHLVDQKTDASNSQTGLAEPCTGIRKRPATDDASSQNKRANRTEENVSDNSPN
AGSVEQTPKKPGLRRRQT
NT seq 597 nt   +upstreamnt  +downstreamnt
atgtcaaacgtacgagtgtctaacgggagcccgagcttggagcggatggacgccaggcag
gcggagtaccctaagccctccgcctgtagaaaccttttcggccccgtgaatcacgaagag
ttaacccgggacttggagaagcactgccgagacatggaagaggcaagccagcgcaagtgg
aattttgatttccagaatcacaggcccctagagggcaaatacgaatggcaggaggtggaa
aagggcagcttgcccgaattctactacagacccccgcggccacccaaaggcgcctgcaag
gtgcccgcgcaggagagccaggatgtccgcgggaaccgccagtcggggccactaattggg
tctcaggccaactcagaggatacacacttggtagaccaaaaaactgatgcatccaacagc
cagacgggcttagcggagccgtgcactgggatacggaagcgacctgcaacagacgatgcc
tcttctcaaaacaaaagagccaacagaacagaagaaaatgtttcagataattccccgaac
gcgggttcagtggagcagacgcccaagaaaccgggcctcagaagacgtcaaacgtaa

DBGET integrated database retrieval system