KEGG   Desmodus rotundus (common vampire bat): 112319061
Entry
112319061         CDS       T05907                                 

Gene name
MDM2
Definition
(RefSeq) E3 ubiquitin-protein ligase Mdm2 isoform X1
  KO
K06643  E3 ubiquitin-protein ligase Mdm2 [EC:2.3.2.27]
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro01522  Endocrine resistance
dro01524  Platinum drug resistance
dro04068  FoxO signaling pathway
dro04110  Cell cycle
dro04115  p53 signaling pathway
dro04120  Ubiquitin mediated proteolysis
dro04144  Endocytosis
dro04151  PI3K-Akt signaling pathway
dro04218  Cellular senescence
dro04625  C-type lectin receptor signaling pathway
dro04919  Thyroid hormone signaling pathway
dro05163  Human cytomegalovirus infection
dro05165  Human papillomavirus infection
dro05169  Epstein-Barr virus infection
dro05200  Pathways in cancer
dro05202  Transcriptional misregulation in cancer
dro05203  Viral carcinogenesis
dro05205  Proteoglycans in cancer
dro05206  MicroRNAs in cancer
dro05214  Glioma
dro05215  Prostate cancer
dro05218  Melanoma
dro05219  Bladder cancer
dro05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:dro00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    112319061 (MDM2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112319061 (MDM2)
   04151 PI3K-Akt signaling pathway
    112319061 (MDM2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112319061 (MDM2)
  09143 Cell growth and death
   04110 Cell cycle
    112319061 (MDM2)
   04115 p53 signaling pathway
    112319061 (MDM2)
   04218 Cellular senescence
    112319061 (MDM2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    112319061 (MDM2)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    112319061 (MDM2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112319061 (MDM2)
   05202 Transcriptional misregulation in cancer
    112319061 (MDM2)
   05206 MicroRNAs in cancer
    112319061 (MDM2)
   05205 Proteoglycans in cancer
    112319061 (MDM2)
   05203 Viral carcinogenesis
    112319061 (MDM2)
  09162 Cancer: specific types
   05214 Glioma
    112319061 (MDM2)
   05220 Chronic myeloid leukemia
    112319061 (MDM2)
   05218 Melanoma
    112319061 (MDM2)
   05219 Bladder cancer
    112319061 (MDM2)
   05215 Prostate cancer
    112319061 (MDM2)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    112319061 (MDM2)
   05169 Epstein-Barr virus infection
    112319061 (MDM2)
   05165 Human papillomavirus infection
    112319061 (MDM2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    112319061 (MDM2)
   01522 Endocrine resistance
    112319061 (MDM2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dro04131]
    112319061 (MDM2)
   04121 Ubiquitin system [BR:dro04121]
    112319061 (MDM2)
Enzymes [BR:dro01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     112319061 (MDM2)
Membrane trafficking [BR:dro04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    112319061 (MDM2)
Ubiquitin system [BR:dro04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   MDM2/MDM4 proteins
    112319061 (MDM2)
SSDB
Motif
Pfam: zf-C3HC4_3 SWIB zf-RanBP zf-RING_2 DUF1229 zf-FPG_IleRS
Other DBs
NCBI-GeneID: 112319061
NCBI-ProteinID: XP_024432050
LinkDB
Position
Unknown
AA seq 491 aa
MCNTSMSVSTDGAVSTSQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVIFYLGQY
IMNKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVVNKQEPPDSGT
SGSDNRCHLEGGSGQKDSVQELQEEKPSSSDSVSRPSTSSRRRTVSETEENSDELPGECQ
RKRHKSDSISFSFDESLALCVIRELRCERSSSSESAGTPSNPDLDAGVSEQSGDWLDQDS
VSDRFSVEFEVESLNSEDYNLSEEGQELSDEDDEVYQVTVFEAEESDTDSFEDDPEISLA
DYWKCTSCNEMNPPLPSHCNRCWALRENWLPEDKGEEQGNMPEKTELENSTQVEEGFDVP
DCKKTAGNDSQESCVEENDEKITQASQSQESEDFSQPSTSSSIIYSSQEDIKEFEKEDTQ
DKEEIVESNLPSNATEPCVICQGRPKNGCIVHGKTGHLMACFTCAKKLKKRNKPCPVCRQ
PIQMIVLTYFS
NT seq 1476 nt   +upstreamnt  +downstreamnt
atgtgcaataccagtatgtctgtgtctaccgatggtgctgtaagtacctcacagattcca
gcttcggaacaagagaccctggttagaccaaagccattgcttttaaagttgttaaaatct
gtcggtgcacaaaaagacacttacactatgaaagaggttatattttatcttggccagtat
attatgaataaaagattatatgatgagaagcaacagcatattgtgtattgttcaaatgat
cttctaggggatttgtttggagtgccaagtttctctgtgaaagaacacaggaaaatatat
acaatgatctacagaaacttggtagtagtcaataagcaggaaccaccagattcaggcacc
tctgggagtgacaataggtgtcacctcgaaggtgggagtggccaaaaggactctgtgcaa
gagctgcaggaagagaaaccttcatcctcggattcggtttctagaccgtctacctcatct
agaaggagaacagtcagtgagacagaagaaaactcagacgaattacctggtgaatgtcaa
aggaagcgccacaaatctgatagtatttccttttcctttgatgaaagccttgctctgtgt
gtaataagggagttacgttgtgaaagaagcagtagcagcgaatcagcagggactccatca
aatccggatcttgatgctggtgtaagtgaacaatcaggtgattggttggatcaggattca
gtttcagatcgattcagtgtagaatttgaagttgagtctttaaactcagaagattataac
ctcagtgaagaaggacaagaactctcagatgaggatgatgaggtgtatcaagttactgtg
tttgaagcagaggagagtgatacagattcatttgaagacgatcctgaaatttccttagct
gactattggaagtgtacttcatgcaatgagatgaatcctccccttccgtcacattgcaac
agatgctgggcccttcgtgagaattggcttcccgaagacaaaggggaggaacaaggaaac
atgcctgagaaaactgaactagaaaactcaacacaagtagaagagggctttgatgtccct
gattgtaaaaaaaccgcagggaatgattcccaagaatcatgtgttgaggaaaatgatgaa
aagattacacaagcctcccagtcccaagaaagtgaggacttttctcagccatcaacttct
agtagcatcatatatagcagccaggaagacattaaagagtttgagaaagaagacacacaa
gacaaagaagaaattgtggaatctaatttgcccagtaatgccactgaaccttgtgtgatt
tgccaaggccgacctaaaaatggttgcattgtccatggcaaaacaggacatcttatggcg
tgctttacatgtgcaaagaagctgaaaaaaagaaataagccatgcccagtgtgtagacaa
ccaattcaaatgattgtgctaacttatttctcctag

DBGET integrated database retrieval system