KEGG   Desmodus rotundus (common vampire bat): 112319068
Entry
112319068         CDS       T05907                                 

Gene name
CDK2
Definition
(RefSeq) cyclin-dependent kinase 2
  KO
K02206  cyclin-dependent kinase 2 [EC:2.7.11.22]
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04068  FoxO signaling pathway
dro04110  Cell cycle
dro04114  Oocyte meiosis
dro04115  p53 signaling pathway
dro04151  PI3K-Akt signaling pathway
dro04218  Cellular senescence
dro04914  Progesterone-mediated oocyte maturation
dro04934  Cushing syndrome
dro05160  Hepatitis C
dro05161  Hepatitis B
dro05162  Measles
dro05165  Human papillomavirus infection
dro05166  Human T-cell leukemia virus 1 infection
dro05169  Epstein-Barr virus infection
dro05200  Pathways in cancer
dro05203  Viral carcinogenesis
dro05215  Prostate cancer
dro05222  Small cell lung cancer
dro05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112319068 (CDK2)
   04151 PI3K-Akt signaling pathway
    112319068 (CDK2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112319068 (CDK2)
   04114 Oocyte meiosis
    112319068 (CDK2)
   04115 p53 signaling pathway
    112319068 (CDK2)
   04218 Cellular senescence
    112319068 (CDK2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    112319068 (CDK2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112319068 (CDK2)
   05203 Viral carcinogenesis
    112319068 (CDK2)
  09162 Cancer: specific types
   05226 Gastric cancer
    112319068 (CDK2)
   05215 Prostate cancer
    112319068 (CDK2)
   05222 Small cell lung cancer
    112319068 (CDK2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    112319068 (CDK2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112319068 (CDK2)
   05161 Hepatitis B
    112319068 (CDK2)
   05160 Hepatitis C
    112319068 (CDK2)
   05162 Measles
    112319068 (CDK2)
   05169 Epstein-Barr virus infection
    112319068 (CDK2)
   05165 Human papillomavirus infection
    112319068 (CDK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dro01001]
    112319068 (CDK2)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:dro03032]
    112319068 (CDK2)
   03036 Chromosome and associated proteins [BR:dro03036]
    112319068 (CDK2)
Enzymes [BR:dro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     112319068 (CDK2)
Protein kinases [BR:dro01001]
 Serine/threonine kinases: CMGC group
  CDK family
   112319068 (CDK2)
DNA replication proteins [BR:dro03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    112319068 (CDK2)
Chromosome and associated proteins [BR:dro03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    112319068 (CDK2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Haspin_kinase Kinase-like
Other DBs
NCBI-GeneID: 112319068
NCBI-ProteinID: XP_024432061
LinkDB
Position
Unknown
AA seq 346 aa
MENFQKVEKIGEGTYGVVYKAKNKLTGEVVALKKIRLDTETEGVPSTAIREISLLKELNH
PNIVKLLDVIHTENKLYLVFEFLHQDLKKFMDASALTGIPLPLIKSYLFQLLQGLAFCHS
HRVLHRDLKPQNLLINAEGAIKLADFGLARAFGVPVRTYTHEVVTLWYRAPEILLGCKYY
STAVDIWSLGCIFAEMHLVCTQHHAKCCGEHRRNGRHSLCPLCSYLEVAASQGGGMTAVS
TPHPVTRRALFPGDSEIDQLFRIFRTLGTPDEVVWPGVTSMPDYKPSFPKWARQDFSKVV
PPLDEDGRSLLSQMLHYDPNKRISAKAALTHPFFQDVTKPVPHLRL
NT seq 1041 nt   +upstreamnt  +downstreamnt
atggagaacttccaaaaagtggaaaagatcggagagggcacgtacggagttgtgtacaaa
gccaaaaacaagctgacgggagaagtggtggcgcttaaaaaaatccgcctggacactgag
acagagggtgtacccagtactgccattcgagagatctctctgcttaaggagcttaaccac
cctaatattgtcaagctgctggatgtcatccacacagaaaataaactctacctggttttt
gagtttctacatcaggatctcaagaaattcatggatgcctctgctcttactggcattcct
cttcccctcatcaagagctacctgttccagctgctccagggcctagctttctgccattct
catcgggtcctgcaccgagacctcaaacctcagaatctgctcatcaacgctgagggggcc
attaagctagcagactttggactagccagagcctttggagttcctgttcgtacctacacc
catgaggtggtgaccctgtggtaccgagcacctgaaatccttctgggctgcaaatactac
tccacagctgtggacatctggagcctgggctgcatctttgctgagatgcacctagtgtgt
acccagcaccatgctaagtgctgtggggaacacagaagaaatggaagacacagtctctgc
ccgctgtgctcctatctagaagtggctgcatcacaaggaggggggatgaccgcagtgtct
accccacaccccgtgactcgccgggccctatttcctggagattctgagattgaccaactc
ttccggatctttcggactctggggaccccagatgaggtggtttggcctggagttacttct
atgcctgattataagccaagtttccccaagtgggcccggcaagattttagcaaagttgtg
cctcccctggatgaagatggacggagcttgttatcgcaaatgctgcactacgaccccaac
aagcggatttcagcaaaggcagctctgactcaccctttcttccaggatgtgaccaagcca
gtaccccaccttcgactctga

DBGET integrated database retrieval system