KEGG   Desmodus rotundus (common vampire bat): 112319116Help
Entry
112319116         CDS       T05907                                 

Gene name
STAT2
Definition
(RefSeq) signal transducer and activator of transcription 2 isoform X1
  KO
K11221  signal transducer and activator of transcription 2
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04062  Chemokine signaling pathway
dro04217  Necroptosis
dro04380  Osteoclast differentiation
dro04621  NOD-like receptor signaling pathway
dro04625  C-type lectin receptor signaling pathway
dro04630  Jak-STAT signaling pathway
dro05160  Hepatitis C
dro05161  Hepatitis B
dro05162  Measles
dro05164  Influenza A
dro05165  Human papillomavirus infection
dro05167  Kaposi sarcoma-associated herpesvirus infection
dro05168  Herpes simplex virus 1 infection
dro05169  Epstein-Barr virus infection
dro05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    112319116 (STAT2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    112319116 (STAT2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    112319116 (STAT2)
   04625 C-type lectin receptor signaling pathway
    112319116 (STAT2)
   04062 Chemokine signaling pathway
    112319116 (STAT2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    112319116 (STAT2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112319116 (STAT2)
  09172 Infectious disease: viral
   05162 Measles
    112319116 (STAT2)
   05164 Influenza A
    112319116 (STAT2)
   05161 Hepatitis B
    112319116 (STAT2)
   05160 Hepatitis C
    112319116 (STAT2)
   05168 Herpes simplex virus 1 infection
    112319116 (STAT2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    112319116 (STAT2)
   05169 Epstein-Barr virus infection
    112319116 (STAT2)
   05165 Human papillomavirus infection
    112319116 (STAT2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dro03000]
    112319116 (STAT2)
Transcription factors [BR:dro03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    112319116 (STAT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: STAT_alpha STAT2_C STAT_bind STAT_int SH2 IL22 FAM184
Motif
Other DBs
NCBI-GeneID: 112319116
NCBI-ProteinID: XP_024432153
LinkDB All DBs
Position
Unknown
AA seq 860 aa AA seqDB search
MAQWEMLQNLDSPFQDQLHQLYTNSLLPMDIRQYLAVWIEDQNWQEAALGNNNSQANMLF
LHFLDQLNYECARCSQDPERLLLQHNLRKFCRDIQVLGGAGNNKAFPGGPIQLAEMIFNL
LLEEKRILIQAQRAQVEQEEPDLHAPVQSQQHEIESRVLELRTMMEKLVKSLSQLKDQQD
VFCFRYKTQAPVRTASLDPHHTRQQQLLQETLNELDKKRKEVLDDSRALLGRLTTLIELL
LPELEEWKAQQQKACIGAPTNGGLELLQLEKWFTEGAKLLFHLRQLLKELKELSLLVTYQ
NDPLTKGVDMQEAQVMELLQRLLHRAFVVETQPCMPQTPHRPLILRTGSKFTVRTRLLVR
LQEGSESLTAEVFIDRNPPQSQGFRKFNILTSNQKTLTPEKGQSQGLIWDFRYLTLTEQR
SGGSGKGTNKSLLGVTEELHIISFTVKYTYQGLKQELQTDTLPVVITSNTNQLSIAWASV
LWFNLLSSNPQNQQFFSSPPKAPWNLLGPALSWQFSSYVGRGLDQDQLSMLKDKLFGQNS
GNEGALLSWADFTKRESPPGKLPFWTWLDKILDLVHDHLMDLWKDGRIMGFVSRSQERKL
LKKTMSGTFLLRFSETSEGGITCSWVEHQDDDKVDIYSVKPFTKEVLQSLPLTKIIHHYQ
LFTEENIPENPLCFLYPRIPRDEAFGCYYEDKVNLQERKKYLKHKLIVVSNRQVDEVQQP
LEPNLEPEVESLELSPALAPGPEPELGLGLEPLLEEGLDLGPSLEPILGVEQEPNLGPEL
RLEPILDPISQLALEPEPDLPHDLRHLNTKEMEIFRNSMKIEDIMPNGDPLLGGQSTADE
AYAFHPSHFFTDGPLIPSDY
NT seq 2583 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaatgggagatgctgcagaatctcgacagcccatttcaggatcagctgcaccag
ctctacacaaatagcctcctgccaatggacattcgacagtacctggctgtctggattgaa
gaccagaactggcaagaagctgcattgggtaacaataattcccaggctaatatgctattc
ctccacttcttggaccaactaaactatgagtgtgcccgctgcagccaggaccccgagcgc
ttgttgctacagcataacttacgaaaattttgtcgggacattcaggtacttggaggagct
gggaataataaggcctttcccgggggtcctatccaattggctgagatgatctttaatctc
cttctggaagaaaaaagaattctgatccaggctcagagggctcaagtggagcaagaggag
ccagacctccacgcacctgtacagagccagcagcatgagattgaatcccgggtcctggaa
ttaaggactatgatggagaagctggtaaaatccctcagccaactgaaagaccagcaagat
gtcttctgcttccgatataagacgcaggccccagtgaggacagcttctttggacccccat
cataccagacagcagcagcttctgcaggaaaccctcaatgaactggacaaaaagagaaag
gaggtgctggatgactccagagcactgctaggtcgattaactaccctaattgagctactg
ctgcctgagctggaggagtggaaagcccagcaacagaaagcctgcattggagcccccaca
aatggagggttagaacttctccagctagagaagtggttcactgaaggagcaaagctcttg
tttcatctgcggcagctgctgaaggagctgaaggaattgagtctcttggttacctatcaa
aacgaccctctgaccaaaggagtggacatgcaggaggcccaggttatggaattgctacag
cgtctgctccacagagcctttgtggtagaaactcagccctgtatgcctcagactccccat
cgacccctcatcctcaggactgggagcaagttcacggtccgaacaaggctgctggtaaga
ctccaggaaggcagtgagtcgctgactgcagaagtctttattgacaggaatcctcctcaa
tcacagggcttccggaagttcaacattctgacctcaaaccagaaaactttgacccccgag
aaagggcagagtcagggcttaatttgggacttccgttacctgactctgacggagcagcgt
tcaggtggctcaggaaagggcaccaataagagtctgctgggtgtgacagaggaactgcac
attatcagcttcacggtcaaatacacctaccagggtttgaagcaggaactgcaaacagac
accctccctgtggtgattacttcgaacacgaaccagctctcaattgcctgggcctcagtt
ctctggttcaatctgcttagctcaaacccccagaaccagcagttcttctccagccccccc
aaggccccctggaacttgctgggccctgctctcagttggcagttctcatcctacgttggc
cgaggcctcgaccaggaccagctgagcatgctgaaggacaagctgtttggacagaactcc
gggaatgagggtgcgttattgtcctgggccgacttcactaagcgagagagccctcctgga
aagctgccattctggacatggctagacaaaattctggacctggtacacgaccacctgatg
gatctctggaaagatgggcgcatcatgggctttgtaagccggagccaggagcgcaagttg
ctgaagaagaccatgtctggtaccttcctactgcgcttcagtgaaacatcggaagggggc
attacctgctcctgggtggaacaccaggatgatgataaggtggacatctactctgtgaag
cccttcaccaaggaggtgctgcagtcactcccactgaccaaaatcatccaccactaccag
ctgttcactgaggagaacatacccgagaacccactatgcttcctctacccccgaatcccc
cgggatgaggcttttgggtgctactatgaggacaaagttaatctccaagaacgaaaaaag
tacctgaaacacaagctcattgtggtctctaacagacaggtggatgaggtgcaacagcca
ctggagcctaatctggagccagaagtggaatcactagagctgtccccagcgctggcacca
gggccagagccagaactaggcctgggattagagccactgctggaggaagggctggacctg
gggccgtcactggagcccatactgggtgtggaacaagagccaaacctgggaccagaactg
aggctggaacctattctggaccctatttcacagctggcactggagccagagccagatttg
ccacatgacctgagacacttgaacactaaggaaatggaaatcttcaggaacagtatgaag
atcgaagacatcatgccaaacggagacccactgctaggcggccagagcaccgcagatgag
gcttacgccttccaccccagccatttcttcacagatgggccgctgattccttctgactac
tag

DBGET integrated database retrieval system