KEGG   Desmodus rotundus (common vampire bat): 112319119
Entry
112319119         CDS       T05907                                 

Gene name
CDK4
Definition
(RefSeq) cyclin-dependent kinase 4
  KO
K02089  cyclin-dependent kinase 4 [EC:2.7.11.22]
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro01522  Endocrine resistance
dro04110  Cell cycle
dro04115  p53 signaling pathway
dro04151  PI3K-Akt signaling pathway
dro04218  Cellular senescence
dro04530  Tight junction
dro04660  T cell receptor signaling pathway
dro04933  AGE-RAGE signaling pathway in diabetic complications
dro04934  Cushing syndrome
dro05160  Hepatitis C
dro05162  Measles
dro05163  Human cytomegalovirus infection
dro05164  Influenza A
dro05165  Human papillomavirus infection
dro05166  Human T-cell leukemia virus 1 infection
dro05167  Kaposi sarcoma-associated herpesvirus infection
dro05169  Epstein-Barr virus infection
dro05200  Pathways in cancer
dro05203  Viral carcinogenesis
dro05212  Pancreatic cancer
dro05214  Glioma
dro05218  Melanoma
dro05219  Bladder cancer
dro05220  Chronic myeloid leukemia
dro05222  Small cell lung cancer
dro05223  Non-small cell lung cancer
dro05224  Breast cancer
dro05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    112319119 (CDK4)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112319119 (CDK4)
   04115 p53 signaling pathway
    112319119 (CDK4)
   04218 Cellular senescence
    112319119 (CDK4)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    112319119 (CDK4)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    112319119 (CDK4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112319119 (CDK4)
   05203 Viral carcinogenesis
    112319119 (CDK4)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    112319119 (CDK4)
   05225 Hepatocellular carcinoma
    112319119 (CDK4)
   05214 Glioma
    112319119 (CDK4)
   05220 Chronic myeloid leukemia
    112319119 (CDK4)
   05218 Melanoma
    112319119 (CDK4)
   05219 Bladder cancer
    112319119 (CDK4)
   05224 Breast cancer
    112319119 (CDK4)
   05222 Small cell lung cancer
    112319119 (CDK4)
   05223 Non-small cell lung cancer
    112319119 (CDK4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    112319119 (CDK4)
   04934 Cushing syndrome
    112319119 (CDK4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112319119 (CDK4)
   05160 Hepatitis C
    112319119 (CDK4)
   05164 Influenza A
    112319119 (CDK4)
   05162 Measles
    112319119 (CDK4)
   05163 Human cytomegalovirus infection
    112319119 (CDK4)
   05167 Kaposi sarcoma-associated herpesvirus infection
    112319119 (CDK4)
   05169 Epstein-Barr virus infection
    112319119 (CDK4)
   05165 Human papillomavirus infection
    112319119 (CDK4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    112319119 (CDK4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dro01001]
    112319119 (CDK4)
Enzymes [BR:dro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     112319119 (CDK4)
Protein kinases [BR:dro01001]
 Serine/threonine kinases: CMGC group
  CDK family
   112319119 (CDK4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo Kinase-like
Other DBs
NCBI-GeneID: 112319119
NCBI-ProteinID: XP_024432162
LinkDB
Position
Unknown
AA seq 303 aa
MATLRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGAGGGLPVSTVREVALL
RRLEAFEHPNVVRLVDVCATSRTDRETRVTLVFEHVDQDLRTYLDKVPPPGLPVETIKDL
MRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWY
RAPEVLLQSAYATPVDLWSVGCIFAEMFRRKPLFCGNSEADQLSKIFDLIGLPPEDDWPR
DVSLPRGAFSPRGPRPVQSMIPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLQKAEG
SPE
NT seq 912 nt   +upstreamnt  +downstreamnt
atggctacccttcgatacgagccagtggctgagattggtgttggtgcctatgggacggtg
tacaaggcccgtgatccccacagtggccactttgtggccctcaagagcgtgagagtcccc
aatggaggaggtgctggagggggccttcccgtcagcacagttcgtgaggtggccttactg
aggcggctggaagcttttgagcatcccaatgttgtccggctggtggacgtctgtgccacc
tcccggactgacagagagaccagagtgaccctggtgtttgagcatgtggaccaagacctg
aggacgtatctggacaaggtacccccaccaggcttgccagtggagaccattaaggatctg
atgcgccagtttctaagaggcctggatttccttcatgccaactgcattgttcaccgggac
ctgaagccagagaacattctggtgacaagtggtgggacagtcaagctggccgactttggc
ctggccagaatctacagctaccagatggcactcacacctgtggttgttacactctggtac
cgtgctccggaagttcttttgcagtctgcgtatgcaacaccggtggacttgtggagtgtt
ggctgtatctttgcagagatgtttcgccgaaagcctctcttctgcggaaactctgaagct
gaccaattaagcaaaatatttgatctgatcgggctgcccccagaggatgactggccccga
gacgtgtctctaccccgaggagccttttcccccagagggccccgcccagtgcagtccatg
atacctgagatggaggagtctggagcacagctgctgctggagatgctgacttttaaccca
cataagcgaatctctgccttccgagccctgcagcactcttatctacaaaaggcagaaggt
agcccagagtga

KEGG   Desmodus rotundus (common vampire bat): 112319896
Entry
112319896         CDS       T05907                                 

Gene name
CDK6
Definition
(RefSeq) cyclin-dependent kinase 6
  KO
K02091  cyclin-dependent kinase 6 [EC:2.7.11.22]
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04110  Cell cycle
dro04115  p53 signaling pathway
dro04151  PI3K-Akt signaling pathway
dro04218  Cellular senescence
dro04934  Cushing syndrome
dro05160  Hepatitis C
dro05162  Measles
dro05163  Human cytomegalovirus infection
dro05164  Influenza A
dro05165  Human papillomavirus infection
dro05167  Kaposi sarcoma-associated herpesvirus infection
dro05169  Epstein-Barr virus infection
dro05200  Pathways in cancer
dro05203  Viral carcinogenesis
dro05206  MicroRNAs in cancer
dro05212  Pancreatic cancer
dro05214  Glioma
dro05218  Melanoma
dro05220  Chronic myeloid leukemia
dro05222  Small cell lung cancer
dro05223  Non-small cell lung cancer
dro05224  Breast cancer
dro05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    112319896 (CDK6)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112319896 (CDK6)
   04115 p53 signaling pathway
    112319896 (CDK6)
   04218 Cellular senescence
    112319896 (CDK6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112319896 (CDK6)
   05206 MicroRNAs in cancer
    112319896 (CDK6)
   05203 Viral carcinogenesis
    112319896 (CDK6)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    112319896 (CDK6)
   05225 Hepatocellular carcinoma
    112319896 (CDK6)
   05214 Glioma
    112319896 (CDK6)
   05220 Chronic myeloid leukemia
    112319896 (CDK6)
   05218 Melanoma
    112319896 (CDK6)
   05224 Breast cancer
    112319896 (CDK6)
   05222 Small cell lung cancer
    112319896 (CDK6)
   05223 Non-small cell lung cancer
    112319896 (CDK6)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    112319896 (CDK6)
  09172 Infectious disease: viral
   05160 Hepatitis C
    112319896 (CDK6)
   05164 Influenza A
    112319896 (CDK6)
   05162 Measles
    112319896 (CDK6)
   05163 Human cytomegalovirus infection
    112319896 (CDK6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    112319896 (CDK6)
   05169 Epstein-Barr virus infection
    112319896 (CDK6)
   05165 Human papillomavirus infection
    112319896 (CDK6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dro01001]
    112319896 (CDK6)
Enzymes [BR:dro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     112319896 (CDK6)
Protein kinases [BR:dro01001]
 Serine/threonine kinases: CMGC group
  CDK family
   112319896 (CDK6)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo Kinase-like RIO1 FTA2
Other DBs
NCBI-GeneID: 112319896
NCBI-ProteinID: XP_024433066
LinkDB
Position
Unknown
AA seq 326 aa
MEKDGLSRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIR
EVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTE
TIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVV
VTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGE
EDWPRDVALPRQAFHSKSPQPIENFVTDIDEQGKDLLLKCLTFNPAKRISAYGALSHPYF
HDLERCKENLDSHLPPSQNSSEMNTA
NT seq 981 nt   +upstreamnt  +downstreamnt
atggagaaggacggccttagccgcgccgaccagcagtacgagtgcgtggcggagatcggg
gagggcgcctatgggaaggtgttcaaggcccgggaccttaagaacggaggccgtttcgtg
gcgctgaagcgcgtgcgggtgcagaccggcgaggagggcatgccgctttccaccatccgc
gaggtggcggtgctgaggcacctggagaccttcgagcaccccaacgtggtcaggttattt
gatgtgtgcacagtgtcacgaacagacagagaaactaagctaacattagtgtttgaacat
gttgatcaagacttgaccacttacttggataaagttccagagcctggagtgcccactgaa
accataaaggacatgatgtttcagcttcttcgaggtctggactttcttcattctcaccga
gtcgtgcatcgtgacctaaaaccacagaacattctggtgaccagcagcggacaaataaaa
ctggctgacttcggccttgcccgcatctacagttttcagatggctcttacctcagtggtc
gtcacgctgtggtacagagccccggaagtcctgctccagtccagctacgccacccccgtg
gacctctggagtgtcggctgcatatttgcagaaatgtttcgtagaaagcctctttttcgt
ggaagttcagatgtggatcaactaggaaaaatcttggacgtaattggactcccaggagaa
gaggactggcctagagatgtggcccttcccaggcaggcttttcattcaaaatctcctcaa
cctattgagaattttgtgacagatattgacgaacaaggcaaagacctacttctgaagtgt
ttgacatttaatccagccaaaagaatatctgcctacggtgccttgtctcacccatacttc
cacgacctggagaggtgcaaggagaacctggattcccacctgccacccagccagaacagc
tcagagatgaatacggcctga

DBGET integrated database retrieval system