KEGG   Desmodus rotundus (common vampire bat): 112319495
Entry
112319495         CDS       T05907                                 

Gene name
MAD1L1
Definition
(RefSeq) mitotic spindle assembly checkpoint protein MAD1 isoform X1
  KO
K06679  mitotic spindle assembly checkpoint protein MAD1
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04110  Cell cycle
dro04114  Oocyte meiosis
dro04914  Progesterone-mediated oocyte maturation
dro05166  Human T-cell leukemia virus 1 infection
dro05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:dro00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112319495 (MAD1L1)
   04114 Oocyte meiosis
    112319495 (MAD1L1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    112319495 (MAD1L1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    112319495 (MAD1L1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112319495 (MAD1L1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dro03036]
    112319495 (MAD1L1)
Chromosome and associated proteins [BR:dro03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Core SAC proteins
     112319495 (MAD1L1)
SSDB
Motif
Pfam: MAD DUF4200
Other DBs
NCBI-GeneID: 112319495
NCBI-ProteinID: XP_024432561
LinkDB
Position
Unknown
AA seq 716 aa
MDDLGENTTVLSSLRSLNNFISQRMEGGAGLDLPASAPGSLQLQYQQSMQLEERAEQIRS
KSHIIQVEREKMQMQLSHKRARVELERAASTSARSYEREVDRNQELLTRIRQLQEREAEA
EEKVKEQLERSRLCQQSLEATSQRLREKEDSLAEAGETISELKGRISELQWSVMNQELQA
KGLESEKQELQAQLDLQRRKWQEANEKIEELQASQEARTDQEQRIKDLEQKLLLQEQDAV
IVKNMKSELVRLPKVERELKQLREENAYLREVREANSLLREEVEGLQRRLSRQEKMQESL
VDLELEKERLLAKLRSWERLDQTTGLNIRTPEDLSRFVVELQQRELALKDRNSSITSSAR
ELDKVRQQLQEELCQVSTQLLEERKKRETHEALARRLQKRVLLLTKERDGMRAILGSYDS
ELAPAEHSPQLTRRMREAEDMVQKVHAHSSEMEAQLSQALEELGSQKQRADTLEMELKVL
RSQSGPAEQSVLLSREEASELRLKVEELEGERSRLEESKKQLETQLERLTLLGDYDQSKT
KVLHLSANPASEARQCLRQDQARLQEECERLRKLVSTLERGGPVPADLETSCLPSSKEMT
ELKKQVESAELKNQRLKEVFQTKIQEFRKVCYTLTGYQIDITRESQYRLTSMYAERKDDC
LVFKATGPSGATMQLLETEFSRTVPELIELHLLRQDSIPAFLSALTLDLFGRQTLA
NT seq 2151 nt   +upstreamnt  +downstreamnt
atggacgatctgggggagaacaccactgtcctgtcctccctgaggtccctgaacaacttc
atctctcagcggatggagggcggggccgggttggacttgcccgcctctgccccaggctct
ctgcagctgcagtaccagcagagcatgcagttggaagagcgagcagagcagatccggtcg
aagtctcacatcatccaggtcgagcgggagaagatgcagatgcaactgagtcacaagagg
gctcgcgtggagctggagcgagcggccagcaccagtgcccggagctatgagcgcgaggtg
gaccggaaccaggagctcctgacgcgaatccggcagcttcaggagcgggaggcggaggca
gaggagaaggtgaaggagcagctggagcgcagcaggctgtgccagcagagcctggaggcc
accagccagaggctgcgggagaaggaggacagcctggccgaggctggcgagaccatcagc
gagttgaagggcaggatctcggagctgcagtggagtgtgatgaaccaggaactgcaggca
aagggcctggagtccgagaagcaggagctgcaggcgcagctggacttgcagcgcagaaag
tggcaggaggccaatgagaagatcgaggagctccaggcgagccaagaggcgaggacagac
caggagcagaggatcaaggatctggagcagaagctgctcctacaggagcaggatgctgtg
attgtgaagaacatgaagtctgagctggtgcggctgcccaaggtggagcgggagctgaag
cagctgagggaggagaatgcctacctacgggaggtgcgggaggccaacagtctgctccgg
gaggaagtggaggggctgcagcggaggctgagccgccaggagaagatgcaggagagcttg
gttgacctggagctggagaaggagaggctgctggcgaagctgcgaagctgggagcgactg
gaccagaccacgggcttgaacatcaggaccccggaagacctctccaggtttgtcgtggag
ctgcagcagcgagagctggccctcaaggacaggaacagctccatcaccagcagcgcccga
gagctggacaaggtgcggcagcagctgcaggaggagctgtgccaggtcagcacccaactg
ctggaggagaggaagaagcgcgagacacacgaggccttggcccgccggctgcagaagcgc
gtcctgctgctgaccaaggagcgggacgggatgcgcgccatcctcgggtcctacgacagc
gagctggcgccggccgagcactcgccccagctgacccggcgcatgcgagaggccgaggac
atggtgcagaaggtgcacgcccacagctcggagatggaggctcagctgtcgcaggcactg
gaggagctggggagccagaagcagagggcggacacgctggagatggagctgaaggtgctg
cggtcccagtcgggccctgccgagcagagcgtcctgctgtccagggaggaggcgagcgag
cttaggttgaaggtcgaggagctggaaggggagcggagtcgcctggaggagagcaagaag
cagctggagacccagcttgagcggctcaccctgctgggcgactacgaccagagcaagacc
aaggtgctgcacctgagcgcgaacccagccagcgaggcgcggcagtgcctccgccaggac
caggcacggctgcaggaggagtgtgagcggctgcggaagctggtgagcaccctggagaga
ggcggccctgtgccggccgacctggagacttcatgtctgccctcatccaaggagatgaca
gaactgaagaagcaggtggagagcgccgagctgaaaaaccagcggctcaaggaggtcttc
cagaccaagatccaggagttccggaaggtctgctacacgctcacgggctaccagatcgac
atcactagggagagccagtaccggctgacgtccatgtacgccgagcgcaaggacgactgc
ctcgtcttcaaggccacggggccctcgggcgcgacgatgcagctgctggagacggagttc
tcgcggacggtgccagagctcatcgagctgcacctgctgcggcaagacagcatccccgcc
ttcctcagcgccctcaccctcgatctctttggccgccagaccctggcctag

DBGET integrated database retrieval system