KEGG   Desmodus rotundus (common vampire bat): 112320552
Entry
112320552         CDS       T05907                                 

Gene name
TFRC
Definition
(RefSeq) transferrin receptor protein 1
  KO
K06503  transferrin receptor
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04066  HIF-1 signaling pathway
dro04144  Endocytosis
dro04145  Phagosome
dro04216  Ferroptosis
dro04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    112320552 (TFRC)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112320552 (TFRC)
   04145 Phagosome
    112320552 (TFRC)
  09143 Cell growth and death
   04216 Ferroptosis
    112320552 (TFRC)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    112320552 (TFRC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dro01002]
    112320552 (TFRC)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dro04147]
    112320552 (TFRC)
   04090 CD molecules [BR:dro04090]
    112320552 (TFRC)
Peptidases and inhibitors [BR:dro01002]
 Metallo peptidases
  Family M28: aminopeptidase Y family
   112320552 (TFRC)
Exosome [BR:dro04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   112320552 (TFRC)
  Exosomal proteins of colorectal cancer cells
   112320552 (TFRC)
CD molecules [BR:dro04090]
 Proteins
  112320552 (TFRC)
SSDB
Motif
Pfam: Peptidase_M28 TFR_dimer PA
Other DBs
NCBI-GeneID: 112320552
NCBI-ProteinID: XP_024433802
LinkDB
Position
Unknown
AA seq 760 aa
MMDQARSAFSNLFSGEPLSYTRFSLARQVDGDNSRVEMKLAADEEEHDDNHMSNHARVAK
SKRFNGSICYGMIAVIIFFFMGFMIGYLGYCKRVEPKAECEGTESPETVYTEEYLPETSP
HLFWSDLKAMLSEKLNNVEFANTIKRLNENSYVPREAGSQKDESLAFYLEGQFRKFQLSK
AWHDEHFVKIQVKGSAQNAVTVVAVSSDTGYLVENPAGYVAYSKAGTVTGKLIHANFGTK
QDFESLSTPVNGSLVIVRAGKITFAEKVANAESFNAIGVLIYMDYTKFPIVDAELPLFGH
AHLGTGDPYTPGFPSFNHTQFPPSQSSGLPNIPVQTISRACAEKLFENMEGTCPSAWKTD
ASCRLVTTQNRNVKLTVNNVLKETRILNVFGVIKGFEEPVRYVVVGAQRDAWGPGAVKSS
VGTALLLELAQIFSDMVLKGGFKPSRSIVFASWSAGDFGAVGATEWLEGYLSSLHLKAFT
YINLDKAVLSDGNFKVSASPLLYSLIEKTMQDVKHPVTGLSLYRDSNWIKKVEKLSFDNA
AFPFLAYSGIPAVSFCFCEDVDYPYLGTTLDTYEKLFQKVPELNKMARGAAEVAGQLMIK
LTHDVELNLNYDMYNEEILEFVRDMNQFRTDIKEMGLNLQWLYSARGDFFRATSRLTTDY
KNAERTNRFVMREINDRIMRVEYHFLSPYVSPRDSPFRHIFWGSGSHTLSALLEHLKLRR
KNNSAFNETLLRNQLALATWTIQGAANALSGDVWDIDNEF
NT seq 2283 nt   +upstreamnt  +downstreamnt
atgatggatcaagccagatcagcattctctaacttgtttagtggagaaccattgtcatat
acccggtttagtcttgcacggcaagtggatggcgataacagtcgtgtggagatgaaacta
gctgcagacgaggaggagcacgacgacaatcacatgagtaatcatgcccgtgttgcgaaa
tcaaaaaggtttaatggaagtatctgctatggaatgattgccgtaatcatctttttcttc
atggggtttatgattggctacttgggctattgtaaacgtgtagaaccaaaagctgaatgt
gaaggaacagagtctccagagacagtgtatacagaagagtaccttcctgaaacatctccg
catctattttggtcagacctcaaagcaatgttgtcagagaaactgaacaatgtagagttc
gccaacacaatcaagcggctaaatgaaaattcctatgttcctcgtgaggctggatctcaa
aaagatgaaagccttgctttttatctggaaggtcaattccgtaaatttcaactcagcaaa
gcttggcacgatgaacattttgttaagattcaggtcaaaggcagtgctcaaaacgcggtg
accgtagtggctgtgagcagtgacacaggatacctggtggagaaccctgcgggttacgtg
gcatacagtaaggctgggaccgttactggtaaactgatccatgctaattttggcactaaa
caagactttgagagtttaagcactcctgtgaatggatctttagtgattgttagagcaggg
aaaatcacttttgctgaaaaggttgcaaatgctgaaagctttaatgcaattggtgttttg
atctacatggactacactaaatttcccattgttgatgcagaacttccactctttggacat
gctcatctgggaacaggtgacccttacacacccggattcccttccttcaatcacactcag
tttccaccatctcaatcatcagggttgcctaacatacctgtgcagacaatttccagagcc
tgtgcagagaaactgtttgaaaatatggagggaacctgtccttctgcttggaaaacagat
gcttcgtgtaggctggtaacgacacagaataggaatgtgaaactcactgtgaacaatgta
ctgaaagagacaagaattttaaatgtctttggtgttattaaaggctttgaagaaccagtt
cgctatgttgtggtgggggcccagagggatgcctggggccctggagctgtgaagtccagt
gtgggaacagctctcctgttggaacttgcccagatattttctgatatggtcttaaaaggt
ggctttaagcccagcagaagcattgtctttgccagctggagtgcaggagacttcggagct
gtgggagcgactgagtggctagagggatacctttcctccttgcatttaaaggctttcact
tacattaatctggataaagctgtccttagtgacggcaacttcaaggtttctgccagccca
ttgttgtattcacttattgagaaaacgatgcaagatgtgaaacatccagttaccgggctc
tctctatatcgggatagcaactggatcaaaaaagttgagaaactttcttttgataacgct
gctttccctttccttgcatattctggaatcccagcagtttctttctgtttttgtgaggac
gtggattatccttatttaggtactaccctggatacctatgagaaactgtttcagaaagtc
cctgagttgaacaaaatggcacgtggagcagcagaagtggctggccagctcatgattaaa
cttacccatgatgttgaattgaacctgaactatgacatgtataatgaggaaatacttgaa
tttgtgagggatatgaaccagttcagaacagacataaaggagatgggtctgaatctacag
tggctatattctgctcgtggagacttcttccgtgctacttctagactaacgacagattat
aagaatgcagagagaacaaacagatttgtcatgagggaaatcaatgaccgtatcatgaga
gtggaatatcacttcctctcaccgtacgtatctccaagagattctcctttccgacatatc
ttctggggctctggctctcacactctgtccgctttactggagcacttaaagctgcgtcgg
aaaaataacagtgctttcaatgaaacactgttgagaaaccagttggctttagcaacttgg
acaattcagggagctgcaaatgctctctctggtgacgtttgggacattgacaatgaattt
taa

DBGET integrated database retrieval system