KEGG   Desmodus rotundus (common vampire bat): 112321737
Entry
112321737         CDS       T05907                                 

Gene name
HMOX1
Definition
(RefSeq) heme oxygenase 1
  KO
K00510  heme oxygenase 1 [EC:1.14.14.18]
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro00860  Porphyrin and chlorophyll metabolism
dro01100  Metabolic pathways
dro04066  HIF-1 signaling pathway
dro04216  Ferroptosis
dro04978  Mineral absorption
dro05200  Pathways in cancer
dro05206  MicroRNAs in cancer
dro05225  Hepatocellular carcinoma
dro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:dro00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    112321737 (HMOX1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    112321737 (HMOX1)
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    112321737 (HMOX1)
 09150 Organismal Systems
  09154 Digestive system
   04978 Mineral absorption
    112321737 (HMOX1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112321737 (HMOX1)
   05206 MicroRNAs in cancer
    112321737 (HMOX1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    112321737 (HMOX1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    112321737 (HMOX1)
Enzymes [BR:dro01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.18  heme oxygenase (biliverdin-producing)
     112321737 (HMOX1)
SSDB
Motif
Pfam: Heme_oxygenase
Other DBs
NCBI-GeneID: 112321737
NCBI-ProteinID: XP_024435026
LinkDB
Position
Unknown
AA seq 288 aa
MERPQPDTMSQDLSEALKEATKEVHTQAENSEFMKNFQKGQVTEEGFKLMMASLYHVYKA
LEEEIERNKKSLVYVPLYFAEELHRRAALEQDMAFWYGPHWQEAIPYTQATKRYVRRLRE
VGRKEPELLVAHTYTRYLGDLSGGQVLKKIAQKALDLPSSGKGLAFFTFPKITSVTKFKQ
LYRSRMNTLEMTPEVRQRVIEEAKTSFLLNIQLFEELQKLLTGKAEDQSPSQAQGLRRRA
GSWAQGLTPTETPRGKPQPSVLSQASLIRWVLMLSFLVATVAVGLYAM
NT seq 867 nt   +upstreamnt  +downstreamnt
atggagcgcccgcagcccgacaccatgtcccaggatttgtccgaggccctgaaggaggcc
accaaggaggtgcatacccaggcagagaattccgagttcatgaagaattttcagaagggc
caagtgactgaagaaggctttaagctgatgatggcctccctgtaccacgtctacaaggcc
ctggaggaggagattgagcgcaacaagaagagcctggtctacgtccccctctacttcgcg
gaagagctgcaccgtagggctgccctggagcaagacatggccttctggtacgggccccac
tggcaggaggccatcccctacacacaggccaccaaacgctatgtgcggcgactccgagag
gtggggcgtaaggagcctgagctgctggtggcccacacctacacccgctacctgggtgac
ctgtctgggggccaggtcctcaagaagattgctcagaaggccttggacctgcccagctcc
ggcaagggcctggctttcttcaccttccccaaaatcaccagtgtcaccaagttcaagcag
ctgtaccgctcccgcatgaacactctggagatgacccctgaggtcagacaaagggtcatc
gaagaggccaagacctcgttcctgctcaacattcagctgtttgaggagctacagaagctg
ctgactgggaaagctgaggaccagagcccctcgcaggcacaggggctccgccggcgggcc
ggcagctgggcgcaaggcttgactcccacggagactcccagagggaagccccagcccagt
gttctttcccaggcgtctctcatccgatgggttctcatgctcagctttctggtggcaacg
gttgccgtgggcctttatgccatgtga

DBGET integrated database retrieval system