KEGG   Desmodus rotundus (common vampire bat): 112321814
Entry
112321814         CDS       T05907                                 

Gene name
APAF1
Definition
(RefSeq) apoptotic protease-activating factor 1
  KO
K02084  apoptotic protease-activating factor
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro01524  Platinum drug resistance
dro04115  p53 signaling pathway
dro04210  Apoptosis
dro04215  Apoptosis - multiple species
dro05010  Alzheimer disease
dro05012  Parkinson disease
dro05014  Amyotrophic lateral sclerosis
dro05016  Huntington disease
dro05020  Prion disease
dro05022  Pathways of neurodegeneration - multiple diseases
dro05134  Legionellosis
dro05152  Tuberculosis
dro05160  Hepatitis C
dro05161  Hepatitis B
dro05162  Measles
dro05164  Influenza A
dro05168  Herpes simplex virus 1 infection
dro05169  Epstein-Barr virus infection
dro05200  Pathways in cancer
dro05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    112321814 (APAF1)
   04215 Apoptosis - multiple species
    112321814 (APAF1)
   04115 p53 signaling pathway
    112321814 (APAF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112321814 (APAF1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    112321814 (APAF1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112321814 (APAF1)
   05012 Parkinson disease
    112321814 (APAF1)
   05014 Amyotrophic lateral sclerosis
    112321814 (APAF1)
   05016 Huntington disease
    112321814 (APAF1)
   05020 Prion disease
    112321814 (APAF1)
   05022 Pathways of neurodegeneration - multiple diseases
    112321814 (APAF1)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    112321814 (APAF1)
   05152 Tuberculosis
    112321814 (APAF1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    112321814 (APAF1)
   05160 Hepatitis C
    112321814 (APAF1)
   05164 Influenza A
    112321814 (APAF1)
   05162 Measles
    112321814 (APAF1)
   05168 Herpes simplex virus 1 infection
    112321814 (APAF1)
   05169 Epstein-Barr virus infection
    112321814 (APAF1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    112321814 (APAF1)
SSDB
Motif
Pfam: NB-ARC WD40 APAF1_C ANAPC4_WD40 CARD Ge1_WD40 eIF2A WD40_like CARD_2 Nup160 AAA_16 Hira Utp8 AAA_22 AAA_18
Other DBs
NCBI-GeneID: 112321814
NCBI-ProteinID: XP_024435162
LinkDB
Position
Unknown
AA seq 1249 aa
MDAKARNCLLQHREALEKDIKTSYIMDHMISDGVLTPSEEEKVKNEPTQQHRAALLIKMI
LKKDNYSYISFYNALLHEGYKDLAVLLHGGLPVLSSSNGKDSVGGITSYVRTVLCEGGVP
QRPVVFVTRKKLVNAIQQKLFKLNGEPGWVTVYGMAGCGKSVLAAEAVRDHVFLEDCFPG
GVHWISVGKQDKSGLLMKLQNLCTRLDQDESFSQRLPLNIEEAKDRLRILMLRKHPRSLL
ILDDVWDPWVLKAFDNQCQILLTTRDKSVTDSVMGPKYVVPVESGLGKEKGLEILSLFVN
MKKSDLPEQAHSIIKECKGSPLVVSLIGALLRDFPNRWEYYLRQLQNKQFKRIRKSSSYD
YEALDEAMSISVDMLREEIKDYYTDLSIFQKDVKVPTKVLCVLWDMETEEVEDILQEFVN
KSLLFCDRNGKSFRYYLHDLQVDFLTEKNRTQLQDLHKKMITQFQRHRQPHTLSLDQEDC
MYWYNYLAYHMASANMQKELRALMFSLDWIRAKTELVGPAHLIHEFVEYRHILDEKDCAV
CENFQEFLSLNGHLLGRQPFPNIVQLGLCEPEASEVYQQAKLQAKREVDNGMRYLEWINK
KTIKNLSRLVVRPHTDTVYHACFSADGHRIASCGADKTLQVFKAETGEKLLEIKAHEDEV
LCCAFSADDKFIATCSGDKKVKVWNSVTGQLVRSYDEHSEQVSCCRFTHNSHPLLLATGS
SDGVLKLWDLNQEPCRNTLLGHNNSANHCRFSPDDKLLASCSADGTLKLWDVKSANERKT
INVKQFFLSSEEPQEDMEVIVKCCSWSSDGSRIMVAAKNKIFLFDIHTSGLLSEIHMGHH
STIQYCDFSPHNPLALVALSQYCVELWNVDSCLKVADCRGHLSWVHCVMFSPDGSSFLTS
SDDQTIRLWETKKVCEDSAIVLKQEIDVVFQENEVMVLAVDNIRRLQLINGKTGQIDYLT
EAQVSCCCLSPNLEYVAFGDSGGTIAILELLNNRIFRSRIGHQNTVWHIQFTADGKTLIS
SSDDPTIQVWHWQSEDYVFLQAHRETVKDFRLLKNSRLLSWSFDGTVKVWNIATGKVEKD
FACHQDTVLSCDISADAAKFSSTSADKTAKIWSFELPSPLHELEGHKGCVRCSAFSVDSS
LLATGDDNGEIRIWNVSDGELLHLCAPISIEEGAATHGGWVTDLCFSPDSRTLVSAGGYL
KWWNVVTGESSQTFYTNGTNLKKIHVAPDFKTYVTVDNLGILYILQILE
NT seq 3750 nt   +upstreamnt  +downstreamnt
atggatgcaaaagctcgaaattgtttgcttcaacacagagaagccctggaaaaggacatc
aaaacatcctacataatggatcacatgattagtgacggagttttaacaccctcagaggag
gaaaaagtaaaaaatgagcctactcaacagcatcgagcagcattgctaattaaaatgata
cttaaaaaagataattattcctacatatcattctacaatgctttactacatgaagggtat
aaagatcttgccgtccttctccatggtggccttcctgtcctctcttcttccaatggcaaa
gattcagttggtggaataacttcatatgtgagaacagtcctgtgtgaaggaggagtacca
cagaggccagttgtttttgttactaggaagaagctggtgaatgcaattcagcagaagctc
ttcaaactgaatggtgaaccaggatgggtcactgtatatggaatggcaggttgtgggaag
tctgtattagctgcagaagctgttagagatcatgtcttcttagaagattgtttcccaggt
ggtgtgcattggatttcggttgggaaacaagacaaatctgggcttctgatgaaactacag
aacctttgtacacggttggatcaggatgagagtttctcccagaggcttccacttaatatt
gaagaggctaaagaccgtctccgtatcctgatgctgcgcaaacacccaaggtctctgttg
atcttggatgatgtttgggatccttgggtgttaaaagcttttgacaaccagtgtcagatt
cttcttacaaccagagacaagagtgttacagattcagtaatgggtccgaaatatgtagtt
cctgtggagagtggcttaggaaaagaaaaaggacttgaaattttatccctttttgttaat
atgaagaaatcagatttgccagaacaagctcatagtattataaaagaatgtaaaggctct
cctcttgtagtgtctttaattggtgctcttttacgtgactttcccaaccgctgggagtac
tacctcaggcaacttcagaataagcagtttaagaggataaggaaatcttcatcttatgat
tatgaggccctggatgaagccatgtctataagtgtggacatgctcagagaagagatcaaa
gattactacacagatctctccatctttcagaaggatgttaaggtgcctacaaaggtgtta
tgtgttctctgggacatggaaactgaagaagttgaagacatactgcaggagtttgttaat
aagtctctcttattctgtgaccggaacggaaaatcatttaggtattatttgcatgatctt
caagtagatttccttacagagaagaaccgcacccagcttcaggatctgcataagaagatg
atcactcaattccagagacatcgccagccacataccctttcattagatcaggaggactgc
atgtactggtacaactacctggcctatcacatggccagtgccaatatgcagaaagaactt
cgtgctttaatgttttccctggattggattagagcaaaaacagaactcgtgggccctgct
catctgattcatgaatttgtggagtaccggcatatactggatgaaaaggattgtgcagtc
tgtgagaatttccaggagtttctatctttaaatggacatcttcttggacgacaaccattt
cctaatattgtacagctgggtctctgtgaaccggaagcttcagaagtgtatcagcaggct
aagctgcaggccaagcgggaggtcgataatggaatgcgctacctggagtggataaacaaa
aaaaccatcaagaatctgtcccgcctggtcgtccgcccccacacagatactgtttaccat
gcttgcttttctgcggatggtcacagaatagcttcttgtggagccgataaaaccttacag
gtgttcaaagctgaaacaggagagaaacttctagaaatcaaagctcatgaagatgaagtg
ctttgctgtgcattctccgcagatgacaaatttatagcaacctgctcaggggataaaaaa
gtgaaggtctggaactctgtgaccgggcaactagtgcgcagctacgatgagcactcagag
caagtcagttgttgccgctttacccacaacagtcacccccttctcttagccactgggtcc
agcgacggtgtcctcaaactctgggatttgaatcaagaaccttgtcgaaataccttgtta
ggccataacaattcagccaatcactgcagattttcaccagacgataagcttttggctagt
tgttcagctgatggaacattaaagctttgggatgtgaaatcagcaaatgagaggaaaacc
attaatgtgaagcagttcttcctaagctcagaggagcctcaagaggacatggaagtgata
gtgaaatgttgttcgtggtcttctgatggttctaggataatggtggccgccaaaaataaa
atctttctttttgacattcataccagtggtctattgtcagaaatccatatgggccatcac
agcaccatccaatactgtgacttctccccccataaccctttggcactggtggctttgtcc
cagtactgtgtggagctgtggaatgtggactcgtgtttaaaagtagctgattgcagagga
catttaagttgggttcattgtgtgatgttttctcctgatggatcatcatttttgacttct
tctgatgaccagacaatcaggctctgggagacaaagaaagtatgtgaggactctgctata
gtgttaaagcaagaaatagatgttgtatttcaagaaaatgaagtgatggttcttgcagtt
gacaatataagacgcctgcaactcattaatggaaaaacaggtcagattgattatctgact
gaagctcaagtcagttgctgctgcttaagtccgaatcttgagtacgttgcgtttggagac
agcggtggaaccattgcgattttagaacttctaaacaacaggatcttccgatccaggatc
gggcaccagaacactgtgtggcacatccagttcacagctgatggaaagactctaatctcc
agctccgatgatcctacaattcaggtatggcattggcaatctgaggactatgtctttctg
caagcccaccgggaaacagtgaaagactttaggctcttgaaaaattcaagactactttcc
tggtcatttgatggcacagtgaaggtatggaatattgctactgggaaagtagagaaggac
tttgcctgtcaccaggacacagtgctttcttgtgacatttctgctgatgctgccaagttt
tcatctacctctgctgacaagactgcaaagatttggagttttgaactcccttcccctctt
catgaattggagggccacaaaggctgtgtgcgctgctctgccttctccgtggacagttcc
ctgttggcaactggcgatgacaatggagaaatcaggatatggaatgtgtcagacggggag
cttcttcatttatgtgctccaatttccatagaagaaggagccgctacccacggaggctgg
gtgaccgacctctgcttttctccagatagcagaacgctcgtctctgccgggggctatctt
aagtggtggaatgttgtcactggggaatcctcacagaccttctacacaaatggaaccaac
cttaagaaaatacatgtggcccctgacttcaaaacatatgtgactgttgataatcttggt
attttatatattctacagattttagagtga

DBGET integrated database retrieval system