KEGG   Desmodus rotundus (common vampire bat): 112321956
Entry
112321956         CDS       T05907                                 

Definition
(RefSeq) tumor necrosis factor receptor superfamily member 3-like
  KO
K03159  lymphotoxin beta receptor TNFR superfamily member 3
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04060  Cytokine-cytokine receptor interaction
dro04061  Viral protein interaction with cytokine and cytokine receptor
dro04064  NF-kappa B signaling pathway
dro04066  HIF-1 signaling pathway
dro04672  Intestinal immune network for IgA production
dro05166  Human T-cell leukemia virus 1 infection
dro05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    112321956
   04066 HIF-1 signaling pathway
    112321956
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    112321956
   04061 Viral protein interaction with cytokine and cytokine receptor
    112321956
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    112321956
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    112321956
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112321956
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:dro04050]
    112321956
Cytokine receptors [BR:dro04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   112321956
SSDB
Motif
Pfam: TNFR_c6
Other DBs
NCBI-GeneID: 112321956
NCBI-ProteinID: XP_024435336
LinkDB
Position
Unknown
AA seq 421 aa
MRRPWAASPRGLAWGPLILGLFGLLAASQPQLVPPYYTENQTCRDQEKEYYEPKHQACCS
RCPPGTHVSAECGRGQDTVCATCPENSYNEHWNHLLSCQLCRPCDQVLGFEETAPCTSKQ
KTQCHCQPGMFCRLWDWECIHCEPLSDCPPGTEAELKGEVGEAGNTCVPCKKGHFQNTSS
PSARCRPHTRCEDQGLVEAAPGTNQSDTRCRNPSETPEMPGTMLVLAIVLPLVFLMLITT
ILACTWKNHPPLCRKLGFLLKRRPEGEESNITDGNWEPPSVNPHFPDLVKPLLPIPGDLP
PAPAWPPMTPALEEDVVQQQSPLSQARKLEAELPEHGQKAHGTNGIHVTGGSVTVTGNIY
IYNGPVLGGARGPGDPPAPQEPPYPIPEEGAPGPPGLSTPYQEDGKAWHLAETETLGCHA
L
NT seq 1266 nt   +upstreamnt  +downstreamnt
atgcgccggccttgggccgcctccccccggggcctggcctgggggccactcatactaggc
ctcttcggtctcctggcagcatcccagccccaactggtgcccccatactacacggagaac
caaacctgccgggaccaggaaaaggagtactacgaacccaagcaccaggcctgctgctcc
cgctgccccccaggcactcatgtctcagctgaatgtggccgcggccaggatacagtttgt
gccacgtgccctgaaaattcctacaatgagcactggaaccatctcctctcctgccagctg
tgccgaccctgtgaccaggtactgggcttcgaggagactgcaccttgcactagcaaacag
aaaacccagtgccactgccagccaggaatgttctgccgcctttgggactgggagtgtatc
cactgcgagccactctcagactgtccaccaggcactgaagctgagctcaaaggtgaagtt
ggagaggctggtaacacctgtgtgccctgtaaaaaagggcacttccagaacacctcctcc
cccagcgcccgctgccggccccacaccaggtgtgaagaccagggcctggtagaggcagca
ccaggcaccaaccagtctgacaccagatgcagaaatccatcagagacccccgagatgcca
ggaactatgctggtgctggccattgtgctgccgctggtcttcttgatgctcatcaccacc
atcctcgcctgcacctggaagaaccacccccctctctgcagaaagcttggattcctgctc
aagaggcgcccagagggagaggaatccaatattactgatggaaactgggagcctccaagc
gtcaacccacattttcctgacctcgtaaaaccacttctgcccatccctggagacttacct
ccagccccagcctggcccccaatgaccccagctttggaggaagatgttgtacagcaacag
agtcccctgagccaggccaggaagctggaggctgaactcccagagcatggccagaaggcc
cacggtaccaatggcattcatgtcaccggtgggtctgtgactgtcactggcaacatctac
atctacaatgggccagtactgggaggagcacggggccctggagacccccctgccccccaa
gagcctccataccccatccctgaagagggtgcccctggtcctcccgggctctctacaccc
taccaggaagatggcaaagcttggcacctggccgagacagagacactggggtgccatgcc
ctctaa

DBGET integrated database retrieval system