KEGG   Desmodus rotundus (common vampire bat): 112322688
Entry
112322688         CDS       T05907                                 

Gene name
SMAD2
Definition
(RefSeq) mothers against decapentaplegic homolog 2 isoform X1
  KO
K04500  mothers against decapentaplegic homolog 2
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04110  Cell cycle
dro04144  Endocytosis
dro04218  Cellular senescence
dro04350  TGF-beta signaling pathway
dro04371  Apelin signaling pathway
dro04390  Hippo signaling pathway
dro04550  Signaling pathways regulating pluripotency of stem cells
dro04659  Th17 cell differentiation
dro04926  Relaxin signaling pathway
dro04933  AGE-RAGE signaling pathway in diabetic complications
dro05142  Chagas disease
dro05166  Human T-cell leukemia virus 1 infection
dro05200  Pathways in cancer
dro05205  Proteoglycans in cancer
dro05210  Colorectal cancer
dro05212  Pancreatic cancer
dro05225  Hepatocellular carcinoma
dro05226  Gastric cancer
dro05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    112322688 (SMAD2)
   04390 Hippo signaling pathway
    112322688 (SMAD2)
   04371 Apelin signaling pathway
    112322688 (SMAD2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112322688 (SMAD2)
  09143 Cell growth and death
   04110 Cell cycle
    112322688 (SMAD2)
   04218 Cellular senescence
    112322688 (SMAD2)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    112322688 (SMAD2)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    112322688 (SMAD2)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    112322688 (SMAD2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112322688 (SMAD2)
   05205 Proteoglycans in cancer
    112322688 (SMAD2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112322688 (SMAD2)
   05212 Pancreatic cancer
    112322688 (SMAD2)
   05225 Hepatocellular carcinoma
    112322688 (SMAD2)
   05226 Gastric cancer
    112322688 (SMAD2)
  09163 Immune disease
   05321 Inflammatory bowel disease
    112322688 (SMAD2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    112322688 (SMAD2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112322688 (SMAD2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    112322688 (SMAD2)
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 112322688
NCBI-ProteinID: XP_024436038
LinkDB
Position
Unknown
AA seq 467 aa
MSSILPFTPPVVKRLLGWKKSAGGSGGAGGGEQNGQEEKWCEKAVKSLVKKLKKTGRLDE
LEKAITTQNCNTKCVTIPSTCSEIWGLSTPNTIDQWDTTGLYSFSEQTRSLDGRLQVSHR
KGLPHVIYCRLWRWPDLHSHHELKAIENCEYAFNLKKDEVCVNPYHYQRVETPVLPPVLV
PRHTEILTELPPLDDYTHSIPENTNFPAGIEPQSNYIPETPPPGYISEDGETSDQQLNQS
MDTGSPAELSPTTLSPVNHSLDLQPVTYSEPAFWCSIAYYELNQRVGETFHASQPSLTVD
GFTDPSNSERFCLGLLSNVNRNATVEMTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSP
NCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVK
GWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSVRCSSMS
NT seq 1404 nt   +upstreamnt  +downstreamnt
atgtcgtccatcctgccattcactccaccagttgtgaagagactgctggggtggaagaag
tcagctggtggatctggaggagcaggtggaggagagcagaatggacaggaagaaaagtgg
tgtgagaaggcagttaaaagtttggtgaagaagctaaagaaaacaggacgattagatgag
cttgagaaagccatcaccactcaaaattgtaatactaaatgtgtcaccatcccaagcact
tgctctgaaatttggggactgagtacaccaaatacgatagatcagtgggatacaacaggc
ctttacagcttctctgaacaaaccaggtcgcttgatggccggctccaggtgtctcaccgg
aaggggctgccgcatgtcatatattgccggttgtggcgctggcctgatctccacagtcat
catgaactcaaagcaatcgaaaactgcgaatatgcttttaatcttaaaaaggacgaagta
tgtgttaacccttaccactaccagagagtcgagacaccagttctgcctcctgtattagtg
ccacggcacactgagatcctaacagaactaccacctctggatgattatacccactccatt
ccagaaaacactaatttcccagcagggattgagccacagagtaattatatcccagaaacg
ccacctcctggatacatcagtgaagatggagaaacaagtgatcaacagttgaaccaaagt
atggatacaggatctccagcagaactatctcctactactctttcccctgttaatcatagt
ttggatttgcaaccagttacttactcagaacctgcattttggtgttcaatagcctattac
gaattaaaccaaagggttggagaaaccttccatgcgtcacaaccctcactcactgtagat
ggcttcacagatccatcaaattcagagaggttctgcttaggcttactctccaacgtcaac
cgaaatgctacagtggaaatgacaagaagacacataggaagaggagtacgcttatattac
ataggtggggaagtttttgctgagtgcctaagtgatagtgcaatctttgtgcagagcccc
aattgtaatcagagatacggctggcaccctgcaacagtgtgtaaaattccaccaggctgt
aatctgaagatcttcaacaaccaggaatttgctgctcttctggctcagtctgttaatcag
ggttttgaagccgtgtatcagctaactagaatgtgcaccataagaatgagttttgtgaaa
gggtggggagcagaataccgaaggcagacggtaacgagcactccttgctggattgaactt
catctgaatggacctctacagtggttggacaaagtattaactcagatgggatccccttca
gtgcgttgctcaagcatgtcataa

DBGET integrated database retrieval system