KEGG   Desmodus rotundus (common vampire bat): 112322759
Entry
112322759         CDS       T05907                                 

Gene name
BCL2
Definition
(RefSeq) LOW QUALITY PROTEIN: apoptosis regulator Bcl-2
  KO
K02161  apoptosis regulator Bcl-2
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro01521  EGFR tyrosine kinase inhibitor resistance
dro01522  Endocrine resistance
dro01524  Platinum drug resistance
dro04064  NF-kappa B signaling pathway
dro04066  HIF-1 signaling pathway
dro04071  Sphingolipid signaling pathway
dro04115  p53 signaling pathway
dro04140  Autophagy - animal
dro04141  Protein processing in endoplasmic reticulum
dro04151  PI3K-Akt signaling pathway
dro04210  Apoptosis
dro04215  Apoptosis - multiple species
dro04217  Necroptosis
dro04261  Adrenergic signaling in cardiomyocytes
dro04340  Hedgehog signaling pathway
dro04510  Focal adhesion
dro04621  NOD-like receptor signaling pathway
dro04630  JAK-STAT signaling pathway
dro04722  Neurotrophin signaling pathway
dro04725  Cholinergic synapse
dro04915  Estrogen signaling pathway
dro04928  Parathyroid hormone synthesis, secretion and action
dro04933  AGE-RAGE signaling pathway in diabetic complications
dro05014  Amyotrophic lateral sclerosis
dro05022  Pathways of neurodegeneration - multiple diseases
dro05132  Salmonella infection
dro05145  Toxoplasmosis
dro05152  Tuberculosis
dro05161  Hepatitis B
dro05162  Measles
dro05168  Herpes simplex virus 1 infection
dro05169  Epstein-Barr virus infection
dro05170  Human immunodeficiency virus 1 infection
dro05200  Pathways in cancer
dro05206  MicroRNAs in cancer
dro05210  Colorectal cancer
dro05215  Prostate cancer
dro05222  Small cell lung cancer
dro05226  Gastric cancer
dro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:dro00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    112322759 (BCL2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    112322759 (BCL2)
   04630 JAK-STAT signaling pathway
    112322759 (BCL2)
   04064 NF-kappa B signaling pathway
    112322759 (BCL2)
   04066 HIF-1 signaling pathway
    112322759 (BCL2)
   04071 Sphingolipid signaling pathway
    112322759 (BCL2)
   04151 PI3K-Akt signaling pathway
    112322759 (BCL2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112322759 (BCL2)
  09143 Cell growth and death
   04210 Apoptosis
    112322759 (BCL2)
   04215 Apoptosis - multiple species
    112322759 (BCL2)
   04217 Necroptosis
    112322759 (BCL2)
   04115 p53 signaling pathway
    112322759 (BCL2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112322759 (BCL2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    112322759 (BCL2)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    112322759 (BCL2)
   04928 Parathyroid hormone synthesis, secretion and action
    112322759 (BCL2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112322759 (BCL2)
  09156 Nervous system
   04725 Cholinergic synapse
    112322759 (BCL2)
   04722 Neurotrophin signaling pathway
    112322759 (BCL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112322759 (BCL2)
   05206 MicroRNAs in cancer
    112322759 (BCL2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112322759 (BCL2)
   05226 Gastric cancer
    112322759 (BCL2)
   05215 Prostate cancer
    112322759 (BCL2)
   05222 Small cell lung cancer
    112322759 (BCL2)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    112322759 (BCL2)
   05022 Pathways of neurodegeneration - multiple diseases
    112322759 (BCL2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    112322759 (BCL2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    112322759 (BCL2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112322759 (BCL2)
   05152 Tuberculosis
    112322759 (BCL2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    112322759 (BCL2)
   05161 Hepatitis B
    112322759 (BCL2)
   05162 Measles
    112322759 (BCL2)
   05168 Herpes simplex virus 1 infection
    112322759 (BCL2)
   05169 Epstein-Barr virus infection
    112322759 (BCL2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    112322759 (BCL2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    112322759 (BCL2)
   01524 Platinum drug resistance
    112322759 (BCL2)
   01522 Endocrine resistance
    112322759 (BCL2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dro01009]
    112322759 (BCL2)
Protein phosphatases and associated proteins [BR:dro01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     112322759 (BCL2)
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Other DBs
NCBI-GeneID: 112322759
NCBI-ProteinID: XP_024436160
LinkDB
Position
Unknown
AA seq 219 aa
MAHAGRTGYDNREIVMKYIHYKLSQRGQEWDAGDASAAAPGATPAPGIFSSXXXXXXXXX
XXXXXXSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRD
GVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVE
LYGPNMRPLFDFSWLSLKALLSLALVGACITLGAYLGHK
NT seq 660 nt   +upstreamnt  +downstreamnt
atggcgcacgccgggagaacagggtatgataaccgggagatagtgatgaagtacatccac
tataagctgtctcagaggggccaggagtgggatgccggagacgcgagcgccgcagccccg
ggggccacccccgcgccgggcatcttctcctccncnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnntcagccctgtgccacctgtggtccacctgaccctgcgccaggcc
ggcgacgacttctcccgtcgctaccgccgggacttcgccgagatgtccagccagctgcac
ctgacgccctttaccgcgaggggacgctttgccacggtggtggaggagctcttcagggat
ggggtgaactgggggaggattgtggccttctttgaattcggtggggtcatgtgtgtggag
agcgtcaaccgggagatgtcgcccctggtggacaacatcgccttgtggatgacagagtac
ctgaaccggcacctgcacacctggatccaggataacggaggctgggacgccttcgtggag
ctgtacggccccaacatgcggcctctgttcgacttctcctggctgtccctgaaggcgctg
ctcagcctggctctggtgggcgcctgcatcacgctgggggcctacctgggccacaagtga

DBGET integrated database retrieval system