KEGG   Desmodus rotundus (common vampire bat): 112322778Help
Entry
112322778         CDS       T05907                                 

Gene name
DCC
Definition
(RefSeq) netrin receptor DCC
  KO
K06765  deleted in colorectal carcinoma
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04360  Axon guidance
dro05200  Pathways in cancer
dro05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    112322778 (DCC)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112322778 (DCC)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112322778 (DCC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Neogenin_C fn3 I-set Ig_3 ig Ig_2 V-set Pur_ac_phosph_N C2-set_2 Ig_4 Interfer-bind Ig_6 EphA2_TM FAM176 Protocadherin V-set_CD47 TMEM154 CD34_antigen DUF4998 Ly49 LYRIC
Motif
Other DBs
NCBI-GeneID: 112322778
NCBI-ProteinID: XP_024436184
LinkDB All DBs
Position
Unknown
AA seq 1447 aa AA seqDB search
MENSLGCVWVPKLAFVLFGAILLSAHLQVTGLQVKAFTSLHFLAEPSDAVTMRGGSVLLN
CSAESDRGVPVITWKKDGIHLALGMDERKQQLPNGSLLIQNILHSRHHKPDEGLYQCEAS
LGDAGSIISRTAKVAVAGPLRFLSQTESVTAFMGDTVLLKCDVIGEPMPTIHWQKNQQDL
TPIPGDSRVVVLPSGALQISRLQPGDVGIYRCLARNPASSRTGNEAEVRILSDPGLHRQL
YFLQRPSSVVAIEGKDAVLECCVSGYPPPSFTWLRGEEVIQLRSKKYSLLGGSNLLISNV
TDDDSGTYTCVVTYKNENISASAELTVLVPPWFLNHPSNLYAYESMDIEFECAVSGKPVP
TVNWMKNGDVVIPSDYFQIVGGSNLRILGVVKSDEGFYQCVAENEAGNAQTSVQLIVPKP
AIPSSSILPSAPRDVVPVLVSSRFIRLSWRPPAEAKGNIQTFTVFFSREGDNRERALNTS
QPGSLQLTVGNLKPEATYTFRVVAYNEWGPGESSQPIKVATQPELQVPGPVENLQAVSTS
PTSILITWEPPAYANGPVQGYRLFCTEVSTGKEQNIEVDGLSYKLEGLKKFTEYTLRFLA
YNRYGPGVSTDDVTVVTLSDVPSAPPQNVSLEVVNSRSIKVSWLPPPSGTQNGFITGYKI
RHRKTTRRGEMETLEPNNLWYLFTGLEKGSQYSFQVSAMTVNGTGPPSNWYTAETPENDL
DESQVPDQPSSLHVRPQTNCIIMSWTPPLNPNIVVRGYIIGYGVGSPYAETVRVDSKQRY
YSIERLESSSHYVISLKAFNNAGEGVPLYESATTRSVTDPTDPVDYYPLLDDFPTSVPDV
STPMLPPVGVQAVALTHDAVRVSWADNSVPKNQKTSEVRLYTVRWRTSFSANAKYKSEDT
TALSYTATGLKPNTMYEFSVMVTKNRRSSTWSMTAHATTYEAAPTSAPKDLTVITREGKP
RTVIVSWQPPLEANGKITAYILFYTLDKNIPIDDWIMETISGDRLTHQIMDLNLDTMYYF
RIQARNVKGVGPLSDPILFRTLKVEHPDKMANDQGRHGDGGYWPVDTNLIDRSTLNEPPI
GQMHPPHGSVTPQKNSNVLVIIVVTVGLLTVLVVVVVAVICTRRSSAQQRKKRATHSAGK
RKGSQKDLRPPDLWIHHEEMEMKNIEKPPGTDPAGRDSPIQSCQELTPVSHSQSETQLGS
KSTSHSGQDTEEAGSSMSTLERSLAARRATRAKLMIPMDAQSNNPAVVSAIPVPTLESAQ
YPGILPSPTCGYPHPQFTLRPVPFPTLSVDRGFGTGKSQSVNEGPTTQQPPMLPPTQPEH
PSSEEAPSRTIPTACVRPTHPLRSFANPLLPPPMSAIEPKVPYTPLLSQPGPTLPKTHVK
TASLGLAGKARSPLLPVSVPTAPEVSEESHKPTEDPANVYEQDDLSEQMASLEGLMKQLN
AITGSAF
NT seq 4344 nt NT seq  +upstreamnt  +downstreamnt
atggagaatagtcttggatgtgtttgggtacccaagctggcttttgtactcttcggagct
atcctgctcagcgcacatcttcaagtcaccggtttgcaggttaaggcgttcacgtcgctg
cacttcctggcagagccttctgatgcggtcaccatgcggggaggaagcgtcctcctgaac
tgctctgcagagtccgaccgaggtgtccccgttatcacgtggaagaaagatggcatccac
ctggccttgggaatggacgaaaggaagcagcaacttccaaatgggtctctgttgatacaa
aacatcctccactccaggcaccataagccagacgagggactttaccaatgcgaagcctct
ttaggagatgctgggtcaatcattagccggacagcaaaagttgcagtagcaggaccactg
aggtttctgtcccagacagaatctgtcacggccttcatgggagacacagtgttactcaag
tgtgatgtcattggggaaccaatgccaaccatacactggcagaaaaaccagcaagacctg
actccaatcccaggtgactcccgggtggtggtgttgccctctggcgctctgcagatcagc
cgacttcaaccaggggacgttggaatctatcggtgcctggcccggaatccagccagttca
agaacaggaaacgaagctgaagtcagaattttatcagacccaggactgcataggcagctg
tatttcctgcagagaccgtccagtgtggtagccatcgaaggcaaagacgccgtcctggag
tgctgtgtttccggctaccctcccccgagcttcacctggttacgaggagaggaagtcatc
caactcaggtccaaaaagtattcattattgggtggaagcaacttgctgatctccaacgtg
acagatgacgacagcggaacttacacctgtgttgtcacatataaaaatgagaatattagt
gcctctgcggagctcacagtcttggttccgccctggtttttaaatcatccttccaacctc
tatgcctatgaaagtatggatattgagtttgaatgtgcagtctctgggaagcctgtgccc
actgtgaattggatgaagaatggagatgtggtcattcctagtgattattttcagatagtg
ggaggaagcaacttacgcatccttggagtggtgaagtcggacgaaggcttttatcagtgt
gtggctgagaacgaggctggaaatgcccagaccagtgtacagctcatcgtccccaagcct
gctatcccaagctccagcatccttccttctgctcccagagatgtggtccccgtcttggtt
tccagtcggttcattcgtctcagctggcgcccacctgcagaagcaaaagggaacattcaa
accttcacggtgtttttctccagagaaggtgacaacagggaacgagcattgaatacatcc
cagcctggatcccttcagcttacggtgggaaacctgaagccagaagccacgtacaccttc
cgcgtcgtggcctacaacgagtgggggcccggggagagttcgcagcccatcaaggtggcc
actcagcccgagttgcaagtcccaggtccagtagaaaacctgcaagctgtatctacctca
cctacctcaattcttattacctgggaaccccctgcctatgcaaatggtccagttcaaggt
tacagattgttctgcactgaggtgtccacggggaaggaacagaatatagaggttgatgga
ctatcttataagctggaaggcctgaaaaaattcacggagtatactcttcgattcctagct
tataatcgctacgggccgggagtgtctactgatgatgtgacggtggttaccctttctgat
gtgcccagtgccccgcctcagaacgtctcgctggaagtggtcaattcaaggagtatcaaa
gtaagctggctgccccctccatcaggaacacagaacggatttattactggctacaaaatc
cgacacagaaagacaacccgcaggggagagatggaaaccctggagccgaacaacctctgg
tacctgttcacaggactggagaaaggaagtcagtacagttttcaagtgtcagccatgaca
gtcaatggcactggaccaccttccaactggtacacagcggagaccccagagaatgatcta
gatgaatcgcaagtccctgaccagccaagctcgcttcatgtgagaccccagaccaactgc
atcatcatgagttggactcctcccttgaacccgaacatcgtggtgcggggttacatcatc
ggctacggcgttgggagcccttacgctgagacagtgcgtgtggatagcaaacagcgatat
tattccattgagaggctagagtcaagttcccattatgtaatctccctaaaagctttcaac
aatgcaggagaaggtgtccctctctatgaaagtgccaccaccagatctgtaacagatccc
actgacccagttgattattatcctttgcttgatgatttccccacctcggtcccagatgtc
tccacccccatgctcccacctgtaggtgtacaggctgtggctcttacccacgatgccgtg
agggtcagctgggcagacaactctgtccctaagaaccaaaaaacatccgaagtgcgactc
tacactgtccggtggaggaccagcttttctgcaaatgcaaaatacaagtcagaagacaca
acagctctgagttacacagcaacaggcctcaaaccaaacacaatgtacgagttctcggtc
atggtaacaaaaaacagaaggtcgagcacgtggagcatgactgcgcatgccaccacgtat
gaagcagctccgacctctgctcccaaagatctgacagtcattactcgggaagggaagcct
cgcacagtcatcgtgagctggcagcctcccttggaagccaacgggaaaattactgcttac
atcttgttctacaccttggacaagaacataccaatcgacgactggattatggagaccatc
agtggtgatcggcttactcatcaaattatggatctcaaccttgacactatgtactacttc
cgaattcaagcacgaaatgtgaaaggcgtggggcccctctccgatcccatcctcttccgg
actctgaaagtggaacaccctgacaaaatggctaatgaccaaggtcgccatggagatggc
ggttattggccggttgatactaatttgattgatagaagcactctcaacgagccacccatt
ggccagatgcaccccccgcatggcagcgtcaccccacagaagaacagcaacgtgcttgtg
atcattgtggtcaccgtgggcctcctcacggtgctggtggtggtggtcgtggccgtgatt
tgcacccggcgctcgtcagcccagcagagaaagaagcgggccacccacagtgctggcaaa
aggaagggcagccagaaggacctgcggccccctgatctctggatccatcatgaggaaatg
gagatgaaaaacatcgagaagccgccaggcaccgacccggcaggaagggactcccccatc
caaagttgccaagagctcactccagtcagtcacagccagtcagaaacgcagctggggagc
aagagcacctctcactcaggtcaagacactgaagaagcaggaagctccatgtccactctg
gagaggtccctggctgctcgccgggccacccgggcaaagctcatgattcctatggatgca
cagtccaacaatcctgctgtcgtgagtgccattcctgtgccaaccctagaaagtgctcag
tacccaggaatccttccatctcccacttgcggataccctcacccgcagttcacgctccgg
cctgtgccgttcccaacgctgtccgtggaccgaggttttggaacaggaaaaagtcagtcg
gtgaatgaagggccaaccacccaacagccacccatgttacccccaacgcagccagagcat
cccagcagtgaggaggcgccaagtagaaccatccccacagcctgtgttcgaccaactcat
ccactccgcagctttgctaaccccttgctacctccaccgatgagtgcaatagagccgaaa
gtcccttacacaccgcttttgtctcagccagggcccactcttcctaagactcatgtgaaa
acagcctctcttgggttggccgggaaggcaagatctcctttgcttcctgtgtctgtgcca
acggcccctgaagtgtctgaggagagccacaagccgacagaggatccagccaatgtgtat
gagcaggatgatttgagtgaacaaatggcaagtttggaagggctaatgaaacagctcaat
gccatcacaggctcggccttttaa

DBGET integrated database retrieval system