KEGG   Desmodus rotundus (common vampire bat): 112322994
Entry
112322994         CDS       T05907                                 

Gene name
SMAD4
Definition
(RefSeq) mothers against decapentaplegic homolog 4
  KO
K04501  mothers against decapentaplegic homolog 4
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04068  FoxO signaling pathway
dro04110  Cell cycle
dro04310  Wnt signaling pathway
dro04350  TGF-beta signaling pathway
dro04371  Apelin signaling pathway
dro04390  Hippo signaling pathway
dro04520  Adherens junction
dro04550  Signaling pathways regulating pluripotency of stem cells
dro04659  Th17 cell differentiation
dro04933  AGE-RAGE signaling pathway in diabetic complications
dro05161  Hepatitis B
dro05166  Human T-cell leukemia virus 1 infection
dro05200  Pathways in cancer
dro05210  Colorectal cancer
dro05212  Pancreatic cancer
dro05220  Chronic myeloid leukemia
dro05225  Hepatocellular carcinoma
dro05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    112322994 (SMAD4)
   04350 TGF-beta signaling pathway
    112322994 (SMAD4)
   04390 Hippo signaling pathway
    112322994 (SMAD4)
   04371 Apelin signaling pathway
    112322994 (SMAD4)
   04068 FoxO signaling pathway
    112322994 (SMAD4)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112322994 (SMAD4)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    112322994 (SMAD4)
   04550 Signaling pathways regulating pluripotency of stem cells
    112322994 (SMAD4)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    112322994 (SMAD4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112322994 (SMAD4)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112322994 (SMAD4)
   05212 Pancreatic cancer
    112322994 (SMAD4)
   05225 Hepatocellular carcinoma
    112322994 (SMAD4)
   05226 Gastric cancer
    112322994 (SMAD4)
   05220 Chronic myeloid leukemia
    112322994 (SMAD4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    112322994 (SMAD4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112322994 (SMAD4)
   05161 Hepatitis B
    112322994 (SMAD4)
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 112322994
NCBI-ProteinID: XP_024436468
LinkDB
Position
Unknown
AA seq 552 aa
MDNMSITNTPTSNDACLSIVHSLMCHRQGGESETFAKRAIESLVKKLKEKKDELDSLITA
ITTNGAHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVKYCQYAFD
LKCDSVCVNPYHYERVVSPGIDLSGLTLQSNAPPSMLVKDEYVHDFEGQPSLSTEGHSIQ
TIQHPPSNRASTETYSTPALLAPSESNATSTTNFPNIPVASTSQPASILAGSHSEGLLQI
ASGPQPGQQQNGFTGQPATYHHNSTTTWTGSRTAPYTPNLPHHQNGHLQHHPPMPPHPGH
YWPVHNELAFQPPISNHPAPEYWCSIAYFEMDVQVGETFKVPSSCPIVTVDGYVDPSGGD
RFCLGQLSNVHRTEAIERARLHIGKGVQLECKGEGDVWVRCLSDHAVFVQSYYLDREAGR
APGDAVHKIYPSAYIKVFDLRQCHRQMQQQAATAQAAAAAQAAAVAGNIPGPGSVGGIAP
AISLSAAAGIGVDDLRRLCILRMSFVKGWGPDYPRQSIKETPCWIEIHLHRALQLLDEVL
HTMPIADPQPLD
NT seq 1659 nt   +upstreamnt  +downstreamnt
atggacaatatgtctattacaaatacaccaacaagtaatgatgcctgtctgagcattgta
catagtttgatgtgccatagacaaggtggagagagtgaaacatttgcaaaaagagcaatt
gaaagtttggtaaagaagctgaaggagaaaaaagatgaattggattctttaataacagcc
attactacaaatggagctcatcctagcaaatgtgttaccatacagagaacattggatgga
aggcttcaggtggcaggtcggaaaggatttcctcatgtgatctatgcccgtctctggagg
tggcctgatcttcacaaaaatgaactaaaacatgttaaatattgtcagtatgcatttgac
ttaaaatgtgatagtgtctgtgtgaatccatatcactatgaacgagttgtatcacctgga
attgatctctcaggattaacactgcagagtaatgctccaccaagtatgttggtgaaggat
gaatatgttcatgactttgagggacagccatcgttatccactgaagggcattctattcaa
accattcagcacccaccaagtaatcgtgcatcgacggagacatacagcaccccagctctg
ttagctccatccgagtctaatgctaccagcaccaccaactttcccaacattcctgtggct
tccacaagtcagcctgccagtatactggcaggcagccatagtgaaggattgttgcagata
gcttcagggcctcagccaggacagcagcagaatggatttactgggcagccagctacttac
catcataacagcactaccacctggactggaagtaggaccgcaccatacacacctaatttg
cctcaccaccaaaacggccatcttcagcaccacccgcctatgccgccccatcccggacat
tactggccagttcacaatgagcttgcattccagcctcccatttctaatcatcctgctcct
gagtattggtgttccatcgcatactttgaaatggatgttcaagtaggagagacatttaag
gttccttcaagctgccctattgttactgttgatggatatgtggacccttctgggggagat
cgcttttgcttgggtcaactctccaatgtccacaggacagaagccattgagagagcaagg
ttgcacataggcaaaggtgtgcagttggaatgtaaaggtgaaggtgatgtttgggtcagg
tgccttagtgaccacgcagtctttgtacagagttactacttagacagagaagctgggcgt
gcgcctggagatgctgttcataagatctacccaagtgcatatataaaggtctttgatttg
cgtcagtgtcatcgtcagatgcagcagcaggcggccactgcacaggctgcagcagctgcc
caggctgcggccgtggcaggaaacatccctggcccaggatcagtgggtgggatagctcca
gcgatcagtttgtcagctgctgctggaattggtgttgatgaccttcgtcgcttatgcata
ctccggatgagttttgtgaaaggctggggaccggattacccaagacagagcatcaaagaa
acgccttgctggattgagattcacttacaccgggccctccagctcctagatgaagtactc
cacaccatgcctattgccgacccacagcctctagactga

DBGET integrated database retrieval system