KEGG   Dehalobacter restrictus: DEHRE_04965Help
Entry
DEHRE_04965       CDS       T02996                                 

Definition
(GenBank) chorismate synthase
  KO
K01736  chorismate synthase [EC:4.2.3.5]
Organism
drs  Dehalobacter restrictus
Pathway
drs00400  Phenylalanine, tyrosine and tryptophan biosynthesis
drs01100  Metabolic pathways
drs01110  Biosynthesis of secondary metabolites
drs01130  Biosynthesis of antibiotics
drs01230  Biosynthesis of amino acids
Module
drs_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:drs00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    DEHRE_04965
Enzymes [BR:drs01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.5  chorismate synthase
     DEHRE_04965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chorismate_synt
Motif
Other DBs
NCBI-ProteinID: AHF09504
LinkDB All DBs
Position
986791..987891
Genome map
AA seq 366 aa AA seqDB search
MSGTWGEYLKLSLFGESHGKCIGIVLDGLPAGLKLDLPFIGRELARRAPGKNPLSTPRKE
KDEFEILSGFFKGTTTGAPLCCVIWNKDQHSGDYSELKDTVRPGHADYTAMVKHRGFNDY
RGGGHFSGRLTAPLVLAGAIAKQVLEKKGIMIGSHILNIGGIREDHFDSLRIDSGLLWKL
TEQEFPILSEEAGIRMKQEILQAKAKEDSVGGVIETAVVGLPAGLGSPFFDSAESKIAHL
LFAVPAVKGVEFGTGFAITQMKGSEANDPYALADDKVVTLSNHNGGILGGITNGMPLLFR
AAVKPTPSIGKVQQTVNMASREETQITVQGRHDPCIVPRAVPVVESAAALALLDLMIEKD
GVTWMN
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgagtggaacatggggtgaataccttaaactatcgttgtttggggaatcacacggaaaa
tgcatcgggatcgtacttgatggtctaccggcgggactaaagcttgatttgcccttcatc
ggccgggaactggccagaagggcaccagggaagaatccgctttcaaccccgcgaaaggaa
aaagacgaatttgaaatcctgagtggtttctttaaaggaactacgactggagccccactc
tgctgtgtgatctggaataaagaccagcactccggggattattccgaattgaaagacacg
gtgcggcccggccatgcggattataccgcgatggtaaaacacagaggcttcaacgactac
cggggcggagggcatttttcaggcagacttacagcgccgctggtattggctggcgcgatt
gccaagcaagtcctggagaagaagggtattatgatcggcagccatattttaaatattggc
ggtataagagaggatcattttgatagcctccgaattgattcagggttgctttggaaactg
acagagcaggaattcccgattctatcggaagaagcgggtattcggatgaaacaggagatt
ctccaggccaaagctaaagaggactctgtcggcggtgtgattgaaactgccgtagtcggt
ttgcccgccggtttggggtcaccattctttgactcagctgaaagtaaaattgcccatctg
ctgtttgctgttccggcggtgaagggagtcgaattcggtactgggtttgcaattacgcag
atgaaaggatccgaagccaatgatccgtatgctctcgcagatgataaagtagtgacgctt
tccaatcacaatggcggaattcttggagggatcacgaatggaatgcctttgctattccgg
gctgccgtgaaaccgacaccttcgattggcaaagtgcagcagacggtgaatatggcctcc
agggaagagacgcaaattacggttcaggggagacacgacccttgcatcgtcccccgggcg
gttcctgtggtagaaagcgccgctgcactggccttattggacttgatgatagaaaaggat
ggggtaacgtggatgaactag

DBGET integrated database retrieval system