KEGG   Dehalobacter restrictus: DEHRE_10900Help
Entry
DEHRE_10900       CDS       T02996                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
drs  Dehalobacter restrictus
Pathway
drs00970  Aminoacyl-tRNA biosynthesis
drs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:drs00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    DEHRE_10900
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:drs03029]
    DEHRE_10900
Enzymes [BR:drs01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     DEHRE_10900
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     DEHRE_10900
Mitochondrial biogenesis [BR:drs03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    DEHRE_10900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: AHF10497
LinkDB All DBs
Position
complement(2165851..2167302)
Genome map
AA seq 483 aa AA seqDB search
MSFNDKYEMVCGVETHVEMATKTKIFCGCTTEFGGEQNTHVCPVCLGLPGVLPVLNKEVV
NLAIKAGLALNCEIAQFSKFDRKNYFYPDLTKNYQTSQYDLPICKNGWLDVTVNGTNKRI
GITRAHMEEDAGKLVHSGETIMTSSSSGVDYNRTGVPLLEIVSEPDMRSIDEVLAYLEQL
VQIMDYAGISDCKLEQGSVRFDINVSLRLKGTEQFGTRTETKNLNSFSSVRRCLEYETER
QAEALDDGQEIIQETRTWDEGRGMTLSLRSKEEAHDYRYFPEPDLMPLVIDRDWVERIRA
SLPELPAAKKARLQSHGLSEYDAGVITASRAMAAFFDQALARINDAKLLANWVMGDLSGL
LKTNGRSFEDSPVSPEQLAGMLTLIKKGDISGKIGKNVLEEIYNTGKDPETIIKEKGLVQ
ISDESELGIIVDGILAANEKSVTDYQAGKESALGFLVGQVMKATRGQANPGLVNKLLKEK
LAQ
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgtcttttaacgataaatatgaaatggtttgcggcgtagaaacccacgtcgagatggca
acgaaaacgaagatcttctgcggctgtacaacggagtttggcggagagcagaacacacac
gtttgtcctgtgtgtctagggctgccgggcgtcctgccggtactgaataaagaagtcgtc
aatctcgcgatcaaggcgggtcttgctttgaactgcgagatcgcccaattctccaaattt
gaccgtaagaactatttctatccggacctaacgaagaattaccagacgtctcagtatgac
ctgccgatctgcaaaaatggctggctcgatgttacggtgaacggaacgaataaacgtatc
ggcatcacgagagcgcatatggaagaagatgccgggaaactggtgcacagcggggagact
attatgacgtccagcagttccggggttgattataaccggacgggtgtaccgcttctggaa
attgtctcggaaccggatatgcgctctatagatgaagttctggcttacctggaacaactg
gtccagatcatggattatgccggaatttccgactgcaaactcgaacagggttccgtccgt
tttgatatcaatgtctcgcttcgcctcaaaggaaccgaacaattcggcacgcggaccgaa
accaagaatttgaactccttcagctcagtccgccgctgtctggaatacgaaaccgagcgt
caggctgaagcactcgacgacggccaagaaatcattcaggaaacgaggacctgggacgaa
ggtagagggatgacgctgtctctccgatccaaggaagaggcccacgactaccgctatttt
ccggagccggatctgatgccgctcgtgatcgaccgagactgggtcgagagaatcagagct
tccttgccggagctgcctgccgccaaaaaagcaagactgcagtcccacggcctgtcggaa
tacgacgcaggggtcattaccgcatccagagcgatggcagcattctttgaccaggcactc
gccaggatcaatgacgcgaaacttcttgccaactgggtcatgggagatttaagcggcctg
ctgaaaaccaacggacgctccttcgaagattcgcccgtctctccggaacagctggcaggg
atgctgacgctgatcaagaaaggtgatatcagcggcaagatcggcaagaatgtgctcgaa
gaaatctataacacaggtaaagatccggaaacgatcataaaagagaaaggacttgtccag
atcagcgatgaaagtgaacttggaataattgtggacggcattcttgctgctaacgaaaaa
tccgtcactgattaccaagccggcaaagagagcgcacttggatttttagtcggtcaggtt
atgaaagcgaccagagggcaggctaatcccggtctggtcaacaaactgctgaaagaaaaa
ctggcacagtaa

DBGET integrated database retrieval system