KEGG   Desulfohalobium retbaense: Dret_0035Help
Entry
Dret_0035         CDS       T00989                                 

Definition
(GenBank) trehalose synthase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
drt  Desulfohalobium retbaense
Pathway
drt00500  Starch and sucrose metabolism
drt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:drt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Dret_0035
Enzymes [BR:drt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     Dret_0035
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     Dret_0035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C Mak_N_cap APH DUF3459
Motif
Other DBs
NCBI-ProteinID: ACV67337
UniProt: C8WZ62
LinkDB All DBs
Position
39394..42723
Genome map
AA seq 1109 aa AA seqDB search
MALQKMIPVTQDPQWYKDAVIYEVPVKSFCDSNGDGIGDFRGLLHKLDYLERLGVTALWL
LPFYPSPLKDDGYDIAEYFSVHKDYGQLQDFKAFLREAHQRGLKVITELVINHTSSDHLW
FKKSRQAEPGSYWRDFYVWSDTPNRYEDARIIFKDFEQSNWTWDPVAGAYYWHRFYSHQP
DLNFDNPEVQKAVFEALDFWLDMGVDGLRLDAIPYLYEREGTNCENLPETHAFLKKLRAH
VDARHRNKMLLAEANQWPEDAVAYFGDGDECHMSFHFPIMPRIFMSLWMEDRFPLIDMIE
QTPEIPAGCQWALFLRNHDELTLEMVSDEERDYMYRVYASDPRARINLGIRRRLAPLMHN
NRRKLELLTLLLLSLPGTPVLYYGDEIGMGDNFFLGDRNGVRTPMQWTPDRNAGFSTANP
QQLYLPVIHDPEYHFQSINVENQEKNPSSLLWWMRRVIAMRRRFRAFSRGAIDFLLPDNE
KVLTFIRSYGEEHILVVVNLSRFSQSVRLDLSEYAGRVPEELFSGNRFPEIGEDPYPLTL
GFNDYFWFVLREPQSRLQTPQGPPRLEMDTDWKHLLHGTFREYLEMEVLPRFLRQSRWFG
SKAKTMRHLQVVEDVNMGHNGEKTHLLVVRVDYTEGGMEHYLLPLSYTDRAEAESLLQEH
PQAVIAYLELQDSSGVLYDGLFSASFRTVLLEMILGQRKKSGPGGEVHGVRGRCLKSLIK
DGHHIPASRVLAAEQSNSSILYGQSVILKLYRRLEQGTNPDAEITRHLGRLRHGPKVPGF
AGLLEYRREDQEPVTLGLAQQYVPSRGDAWTFVLSELDSFWDRVARDETRWQGPEPGWLP
RAGNAAMPEELLDRVGQEFLDKIELLGRRTGELHRALTDSDPESPFAPEPFSKLYQRSLY
QSVRYQVRKTLHSVRRHLDELPEAIRPQAEALLVNEHLVLERLGGLTAHRVEAQKIRIHG
DYHLGQVLYTGEDFWIIDFEGEPARPLSERRLKRSPLRDVAGMLRSFDYAVHTSLSRQES
GVTSAVGRSWTAPWYAAVCRTYLRGYLDQVEDAAFVPRDPEDIWRLLEGFLIEKAVYEVG
YEANNRPHWIWLPLGGLLRLLGKEPDVDS
NT seq 3330 nt NT seq  +upstreamnt  +downstreamnt
atggctttgcagaagatgatccccgtgacccaggacccccaatggtacaaagacgccgtg
atttatgaagtgccggtgaagtccttttgtgacagcaacggggacggcattggcgatttc
cgggggcttttgcataaactggattacctcgagcgcctgggggtgacggcgttgtggctg
ttgccgttttatccttccccgctcaaggatgacggatacgatatcgcggagtatttttcc
gtgcacaaggattacggtcagctacaagatttcaaagcctttttgcgtgaagcccatcaa
cggggattgaaggtcatcactgaattggtcattaatcacacatccagcgatcacctgtgg
ttcaagaaatcccgccaagccgaacccggcagctattggcgcgatttttacgtctggagc
gacacgcccaatcggtacgaagacgcgcggatcatcttcaaggattttgaacaatcgaac
tggacctgggaccctgtagctggcgcctattattggcaccggttctattcgcatcagccg
gacctcaatttcgacaaccctgaagtccaaaaggcggtcttcgaggccctggatttctgg
ctggatatgggcgtcgacggtctgcggctggacgcgatcccctatctctacgaacgtgag
gggacgaattgcgagaatcttccggaaacccacgcgtttttgaaaaagctccgggcccat
gtcgatgccagacatcggaacaagatgctcctggctgaggccaaccaatggccggaagat
gcggtggcctattttggcgacggcgacgaatgccacatgtctttccactttccgatcatg
ccgcgcatcttcatgtccctgtggatggaagaccgcttccccttgatcgacatgattgag
cagacaccggagattccggccgggtgccagtgggcgctgtttttgcgcaaccatgacgaa
ctcaccttggaaatggtctctgacgaagagcgggactatatgtaccgcgtctatgccagc
gacccccgggcacggatcaatctgggcattcggcggcgactggccccgttgatgcacaac
aaccggcgcaaactggaacttttgaccctgctcctgctctccctgccgggcacgccggtg
ctctattatggcgacgagatcggcatgggcgacaattttttcctcggcgatcgcaacggg
gtccggacgcccatgcagtggacgccggaccgcaacgccgggttctctacggccaatccc
cagcagttgtatttgccggttatccacgaccccgaataccattttcagtccatcaacgtc
gaaaaccaggaaaaaaacccctcctccctgttgtggtggatgcggcgggtcatcgccatg
cggcggcgtttccgggcctttagccgtggtgcaatcgattttctcctgccggacaatgaa
aaggtcctgaccttcattcgcagctacggcgaggagcacatccttgtcgtggtcaacctc
tcccggttttcgcaatcggtacgcctggacctctcggaatacgcgggccgggtgccggaa
gaactcttcagcggcaaccggttcccggagatcggcgaggacccctatccattgaccttg
ggattcaacgactatttctggttcgtgctgcgcgagccgcaatcccgactgcagacaccg
caggggccgccgcgcctggagatggacaccgactggaagcacctgctgcacgggaccttc
cgtgagtatctggagatggaagtgctgccgcggtttttgcgtcagagccgctggttcggt
tccaaggccaaaaccatgcgccatctgcaggtcgtggaagacgtgaacatgggccacaac
ggggagaagacccatctgctcgttgtgcgggtcgactataccgaaggagggatggaacac
tatctcctgcccttgtcctatacggaccgggccgaggcggaatccctgctgcaggaacat
ccccaggcggtgatcgcctatcttgagcttcaggacagcagcggcgtcctctatgatggg
cttttcagcgccagcttccgcaccgtgcttttggagatgatcctcggacagcgcaaaaag
agcggtcccggcggcgaggtccacggtgtgcgggggcgttgtctgaaatccctgatcaag
gacggccaccatatccccgcttctcgagttttggccgcggagcagagcaacagttccatc
ctctatggccagtcggtgatcctcaagttgtaccgccgtctggagcagggcacgaatccg
gacgcggagatcactcgtcatcttggccggttgcgtcacgggcccaaggttcccggcttc
gcgggcctgctcgaataccgccgggaggaccaggaacctgtgacccttggcctggcccag
cagtatgtgccgagccgcggcgatgcctggacctttgtcctatcggagttggacagtttt
tgggatcgcgtggcgcgtgatgaaacgcgctggcagggcccggaacccggctggcttccc
cgggccggcaatgccgcgatgccggaggaactgctggatcgggtcggccaggagtttttg
gacaagatcgagctcctggggcggcggaccggagaactccaccgggcgctgaccgattcg
gacccggaatctcccttcgcccccgaaccgttttccaagctttatcagcgctcgctgtac
cagtcggtgcgctatcaggtccgtaaaacgctgcacagtgtgcgtcgccatctggacgag
cttcccgaggcgatccgtccacaggcagaggccttgctggtcaatgagcatctggtgctc
gaacgcctgggcggactgaccgcccatcgggtcgaggcccagaagattcgcatccacggc
gattaccacctcggtcaggtgctttacaccggcgaggatttctggattatagactttgag
ggagagccagccaggccgctgagcgaacggcggttgaagcggtctccactgcgggatgtg
gccgggatgctgcgctctttcgactacgcggtgcacacctcgctctcgcggcaagagagc
ggggtgacctcagcagtcggcaggagttggaccgccccctggtacgccgcggtctgccgg
acgtatctgcgcgggtatctcgaccaggttgaagacgccgctttcgtccccagggatccg
gaggacatctggcgtctgctcgaaggatttttgattgagaaggcggtctacgaagtcggc
tatgaagccaacaaccgtccccactggatttggctccctctcggcggcctgttgcgcctg
ctgggcaaggagcccgatgtggacagttaa

DBGET integrated database retrieval system