KEGG   Desulfohalobium retbaense: Dret_1074Help
Entry
Dret_1074         CDS       T00989                                 

Definition
(GenBank) D-alanine/D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
drt  Desulfohalobium retbaense
Pathway
drt00473  D-Alanine metabolism
drt00550  Peptidoglycan biosynthesis
drt01100  Metabolic pathways
drt01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:drt00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Dret_1074
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Dret_1074
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Dret_1074
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:drt01011]
    Dret_1074
Enzymes [BR:drt01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Dret_1074
Peptidoglycan biosynthesis and degradation proteins [BR:drt01011]
 Precursor biosynthesis
  Amino acid ligase
   Dret_1074
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4 CPSase_L_D2 ATP-grasp
Motif
Other DBs
NCBI-ProteinID: ACV68362
UniProt: C8X239
LinkDB All DBs
Position
complement(1265485..1266393)
Genome map
AA seq 302 aa AA seqDB search
MRILLIAGGWSNERDVSISGGKAIAAALRANGHEVHWFDPAQEFAELPTKARQSDFVFIN
LHGAPGEDGLIQAMLDRLGCPYQGSGPAGSLLALDKTATKTLYAQAGLATPAWELVTSCR
EENWQPALRFPLFIKPNQGGSSLGVQRVYSQKELHPQLSQQLQFSSAVLLEEAVTGKEVT
CAVVGEQALPLVLIEPGDEAAFFDYHSKYTPEAAREICPAPLSETLTAAIQKAALEAHRI
LGLTGYSRTDFILANGTAFALETNTLPGMTPTSLLPQAAAARGQDFNGLLEELIQLGLKR
FS
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgcgtatccttttgatagccgggggctggtcgaacgagcgtgacgtctccatcagcgga
ggcaaagccatcgctgcggccctgcgcgccaacgggcatgaagtgcactggttcgatccc
gcacaggaattcgctgagttgcccacaaaggcacgccagagcgatttcgtgttcatcaat
ctccacggggcgcctggtgaagacggcctcatccaggccatgctggatcggctcgggtgc
ccgtatcaaggatccggtccggccggttccctgctggccctggacaagaccgcaaccaaa
accttatacgcccaggccggccttgcgacaccggcgtgggaactggtgacctcctgccga
gaagagaattggcagcctgccctgcgttttccgctctttatcaaacccaaccagggcggc
tcgagtctgggcgtccaacgcgtctattcccaaaaggaattgcatccccaactctcccag
cagctccagttcagttcggccgtgcttttggaagaggctgtgaccggcaaagaggtcacc
tgtgccgtggtcggcgagcaggccttgccgttggtgctcattgagccgggggacgaagcc
gcctttttcgattaccacagcaaatatactccagaagccgcccgggaaatctgccctgcc
cccctgtctgagaccctcaccgccgccatccagaaagcggccctggaggcccatcggatt
ttagggcttaccggctacagccgcacggatttcattctcgccaacgggacggcctttgcg
ctggagaccaacaccttacccggcatgaccccgacaagcttgctccctcaggccgccgcc
gcccgcggacaagatttcaacggcttattggaggaactcatccagcttggcctgaaacgg
ttctcgtga

DBGET integrated database retrieval system