KEGG   Desulfohalobium retbaense: Dret_1468Help
Entry
Dret_1468         CDS       T00989                                 

Definition
(GenBank) anti-ECFsigma factor, ChrR
  KO
K16953  dimethylpropiothetin dethiomethylase [EC:4.4.1.3]
Organism
drt  Desulfohalobium retbaense
Pathway
drt00920  Sulfur metabolism
drt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:drt00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    Dret_1468
Enzymes [BR:drt01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.3  dimethylpropiothetin dethiomethylase
     Dret_1468
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DMSP_lyase Cupin_7 Cupin_2
Motif
Other DBs
NCBI-ProteinID: ACV68755
UniProt: C8X2V8
LinkDB All DBs
Position
1696925..1697620
Genome map
AA seq 231 aa AA seqDB search
MERGLRPRILEGCTMELSDAVNWYYLLREYYLLYRTLSAGGSKPIRRHKRDVRERISQTM
HPKTPVVHREPAEKPVCAYLQRALDQAPAADRGVVTTLHSLRPHLHWEYGYQRLPAHLAR
KYAYAECVGPRGPVVSERLILGLVLLAPGTTYPTHAHQTITESYIGLSGAFSENDVGVFG
PKSLILNPPGRRHRITVDSYEPCLLAFAWTGYSRDLDDPGMCFSPRTPQAL
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atggaaaggggactgaggccccgtattctggagggatgcacaatggagctgtccgacgcc
gtcaactggtattacttgctgcgcgaatactacctgctctaccgcaccctgtccgccggc
ggcagcaagcccatccggcgccacaaacgcgacgttcgcgaacgcatcagccagaccatg
cacccgaaaacgccggtagtgcaccgcgaacccgccgaaaagccggtctgcgcctacttg
caacgcgccctggaccaggctccggctgccgatcgcggggtggtcaccacgctgcattcc
ttgcggccccatttgcattgggaatacggctaccagcgcttgcccgcccatctggcccga
aaatacgcctatgccgaatgtgtggggccgcgcgggccagtggtctccgagcgtctgatt
ctcgggctggtcctgctcgcgccaggcaccacctaccccacccacgcccaccagacgatc
accgaatcctatatcggcctcagcggggccttttctgaaaacgatgtcggggtcttcggc
cccaagtcgctgattttgaacccgccaggccggcgccaccggatcacggtcgacagctac
gagccctgcctgctcgcctttgcctggaccggctacagccgggatcttgatgatccaggc
atgtgctttagccccaggaccccgcaagcgctgtaa

DBGET integrated database retrieval system