KEGG   Desulfohalobium retbaense: Dret_1971Help
Entry
Dret_1971         CDS       T00989                                 

Definition
(GenBank) short-chain dehydrogenase/reductase SDR
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
drt  Desulfohalobium retbaense
Pathway
drt00061  Fatty acid biosynthesis
drt00780  Biotin metabolism
drt01100  Metabolic pathways
drt01130  Biosynthesis of antibiotics
drt01212  Fatty acid metabolism
Module
drt_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:drt00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Dret_1971
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Dret_1971
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    Dret_1971
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:drt01004]
    Dret_1971
Enzymes [BR:drt01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     Dret_1971
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     Dret_1971
Lipid biosynthesis proteins [BR:drt01004]
 Fatty acid synthase
  Component type
   Dret_1971
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Enoyl_reductase Vint
Motif
Other DBs
NCBI-ProteinID: ACV69255
UniProt: C8X4N2
LinkDB All DBs
Position
2260028..2260792
Genome map
AA seq 254 aa AA seqDB search
MLLQGKKALITGVANNRSIAYAIGKAFKDQGARLAFSYPGEALQKRVEPLSEELGGEFTV
AMDVTDDTEIQQAKDIVADKWGEVDVLVHAIAFAHREDLKGRFLDTSREGFATAMNISAY
SLVAMCHAFEPLLTPEASVMALTYYGSQKVVTNYNVMGVAKATLEASVRYLAVDLGQKQV
RVNAISAGPIKTLAASGISGFKTILNHIEQRAPLQRNVTQEDVGNTAVYLASDLSRGTTG
DILYVDSGYNIMGL
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgctacttcaagggaagaaagcccttatcaccggcgtggccaacaaccgcagcatcgcc
tatgccatcggcaaggccttcaaggaccagggcgcccgcctggccttcagctatcccggc
gaagccctgcaaaagcgggttgagcccctgagcgaagaattggggggcgaattcaccgtg
gcgatggatgtcaccgacgacaccgaaatccagcaggccaaagacatcgtagccgacaaa
tggggtgaagtggatgtcctggtccacgctatcgcctttgcccatcgcgaggacctcaaa
ggcagatttctcgacacttcccgcgaaggctttgccaccgccatgaacatctcggcctac
tccctggtggccatgtgccacgccttcgaaccgctactcacccccgaggcctcggtcatg
gccctgacctactatggctcacaaaaagtcgtgaccaattataatgtcatgggcgtggcc
aaagcgacgctggaagccagtgtacgctacctggcggtcgacctgggccagaagcaggtc
cgggtcaacgccatcagcgccggaccgatcaagaccctggctgcctcgggcatttccggt
ttcaagaccattctcaaccacatcgaacagcgcgctccgctgcaacgcaacgtgacccag
gaggatgtcggcaacaccgcagtctatctggcctccgacctctcccgcggcaccaccggc
gacatcctctatgtggattccggctacaatatcatgggtctctag

DBGET integrated database retrieval system