KEGG   Desulfohalobium retbaense: Dret_2169Help
Entry
Dret_2169         CDS       T00989                                 

Definition
(GenBank) alpha-glucan phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
drt  Desulfohalobium retbaense
Pathway
drt00500  Starch and sucrose metabolism
drt01100  Metabolic pathways
drt01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:drt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Dret_2169
Enzymes [BR:drt01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     Dret_2169
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3417 Phosphorylase Glyco_transf_5
Motif
Other DBs
NCBI-ProteinID: ACV69453
UniProt: C8X4V6
LinkDB All DBs
Position
2465043..2467619
Genome map
AA seq 858 aa AA seqDB search
MQPLQIYSVIPKLPTALQPLWELAYNVWYDWKHEIWDFFSQIDHALWQECQNNPVLFLNR
LPQPTLEELAQDTFFVDRLHEIHTSLREYLTTSSEHVIFDHARTGQPVVAYFSAEYGLSH
SIPIYSGGLGILAGDHLKSASDLNLPLVGIGLAYQHGYFRQYLTPDGWQQERYPVNDFEQ
LPMSLVQTEHGAPLLVHVPVKERSLAARVWRINVGRIALYLLDANTPENPRELRDLTSRL
YGGGDEMRLQQEILLGIGGIRLLRQLDLSPDVIHLNEGHSAFAGLERIRDLMRDKGLPFE
AAKEVVASSSVFTTHTPVPAGNDRFAPPMIREYFQSYSQELRLSHEAFLGLGRENPSDEH
ETFCMTVLALNLSRFNNGVSKRHGEVSRTMWRRNWPQYPVEDVPIGSITNGVHISSWVSR
DFALLFDRYLGSNWREDPDCDRLWRQGEAIPDTELWRTHIRLKEQLVDFVRERLKQQVLA
RSGRPREALLAEEVLDPAVLTIGFGRRFATYKRADLLFRDTQRLIALLNDTEQPIQLIFS
GKAHPRDNEGKRLIQKIVELSQSEECRHRLVFLEDYDMEIARHLLQGCDVWLNTPRPPLE
ACGTSGMKAAANGVLVASTLDGWWGEAYKSDNSLGWSIGRGEVYDDPEYQDFVESQIIYQ
LLEKDIIPLFYDRGKGNIPREWIRRMKKGLMELVPRFNAHRMVEEYAKFAYQPAHTNYHS
LSSEDFQAARNLASWRLSVAEKWGSLSLRNVRAAEQSEVFVEQGIEVQAEVYLDGLSPEE
VRVEIYAGPLNPEGQFIRRTTSLMTSVQVLEDGWHLYKGTTKPAESGRFGFTVRLLPHYP
LAMDPHAVGLIRWAVQGK
NT seq 2577 nt NT seq  +upstreamnt  +downstreamnt
atgcaaccgcttcaaatttatagcgttatccccaaacttcccactgccctccagccgctt
tgggagctggcctacaatgtctggtatgattggaaacacgaaatctgggacttcttctcc
cagatagaccacgctttatggcaggaatgccagaacaacccggtactctttctcaatcgt
ctgccccagcccaccctggaggaattggcccaggacaccttttttgttgaccgcctgcac
gagatccacaccagcttgcgtgaatacctgaccacctcctcggaacatgtcatcttcgac
cacgcccggaccgggcagcctgtggtcgcctacttcagtgccgaatacgggctgagtcac
agcataccgatctattctggaggattgggcatactcgccggggaccatctcaaatcagcc
agcgatctgaatcttccgctggtcgggatcggactggcctaccagcatggctatttccgg
caatacctgaccccagacggctggcaacaggaaaggtatccggtcaacgatttcgaacaa
ctccctatgtcgctggtccagacagagcacggcgccccgctgctcgtccatgtccccgtc
aaggagcgctccctggccgcccgggtctggcgcatcaacgtgggccggattgccctgtat
ctgctcgacgccaatactccggaaaacccgcgtgaactcagagatctgacctcccgcctc
tatggcggcggggatgaaatgcggctccagcaggaaattctcctgggcatcggcggaatc
cgcctgcttcgacagcttgatctctctccggatgtcatccacttgaatgaggggcactcg
gcctttgcggggctggaacgcattcgggatctgatgcgcgacaagggcttgccctttgaa
gcggccaaagaggtcgtagcctcgagttccgtgttcaccacacacacaccggttccggcc
ggaaacgaccgctttgcaccgcccatgatccgggaatattttcagtcctacagccaggaa
ttgcgtctctctcacgaagccttcctcggcttgggcagagaaaacccctcggacgaacat
gaaactttctgcatgaccgtactggccctgaatctctcccgcttcaacaacggggtcagc
aagcgccatggcgaagtctcgcgcaccatgtggcgccgcaactggccccaataccccgtg
gaagacgtccccatcggatccatcaccaatggagtgcatatttcctcctgggtctcacgg
gattttgccctgctctttgaccgctacctgggctcgaattggcgggaagatcctgattgc
gaccggctctggcgccagggcgaggctattccggacactgaactgtggcggacacatatc
cggctcaaggaacaactcgtggattttgtccgtgaacggctcaaacagcaggttctggct
cggagtggccgcccccgggaggcactgctggctgaggaggtcctcgatcccgctgtgctg
accatcggctttggccgccgctttgcgacttacaagcgcgcggacctgctctttcgcgac
acccagcggctgatcgccctgctcaatgacaccgaacagccgatccagctcattttttcc
ggcaaagcccacccccgggacaacgaagggaaacggctgatccaaaaaatcgtggagctc
tcgcagtctgaggaatgccggcaccgcctcgtcttcctcgaggactacgacatggagatc
gcccgccatctcctgcaggggtgcgacgtctggctcaacaccccgcgccccccgcttgag
gcgtgcggcaccagtggcatgaaagctgctgccaacggggtcctggtggccagcaccctg
gacggctggtggggcgaggcctacaaaagcgacaatagcctcggctggtccattggacgc
ggcgaggtctatgacgaccccgaataccaggatttcgtcgaaagccagatcatctatcaa
cttttggaaaaagatatcatcccgctcttttacgatcgcggcaaaggcaatatcccccgg
gaatggatacggcgcatgaaaaaagggctcatggagctggtaccccgcttcaacgcccat
cgcatggttgaagaatacgccaaattcgcctatcagccggcacataccaattaccacagc
ctgtccagcgaagatttccaggcggcgcggaatctggccagctggcgtctctccgtggcc
gagaaatgggggtcattgagtttacgcaatgtccgcgcagcagaacaaagcgaagtcttt
gtcgaacaggggatcgaggttcaggccgaagtctatctggacgggttgagccccgaggag
gtccgggtggagatctacgctggcccccttaacccggaagggcagttcatccggcgcacg
acctccttgatgacctcggtccaggtcctggaagacggctggcatctgtacaagggcacc
acgaaaccagcggagagcggccgtttcggatttacggttcgtcttctgccgcactacccc
ttggcaatggacccccacgccgtaggcctcatccgttgggcggtacaaggcaaatag

DBGET integrated database retrieval system