KEGG   Desulfotomaculum ruminis: Desru_0578Help
Entry
Desru_0578        CDS       T01518                                 

Definition
(GenBank) Uracil-DNA glycosylase superfamily
  KO
K03649  double-stranded uracil-DNA glycosylase [EC:3.2.2.28]
Organism
dru  Desulfotomaculum ruminis
Pathway
dru03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:dru00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    Desru_0578
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:dru03400]
    Desru_0578
Enzymes [BR:dru01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.28  double-stranded uracil-DNA glycosylase
     Desru_0578
DNA repair and recombination proteins [BR:dru03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     Desru_0578
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDG
Motif
Other DBs
NCBI-ProteinID: AEG58863
UniProt: F6DSP4
LinkDB All DBs
Position
596289..596843
Genome map
AA seq 184 aa AA seqDB search
MKGLPDYLAHGLKILFVGYNPGERSAVLGHHFAGRGNQFWRLLYEAGLTPRLYDPTEDGM
LKELGYGLTNLVPRPSKSSSDLSTAEMREGALELRIKVTRYKPAIVCFLGKEVYRRFAGI
SAKSGLSYGPVEGADVTQGVLAFVAPNPSGRSTILYADKLAVFIQLQTMVKAQKLRKDKS
KALG
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
ttgaaggggttaccggattacttggctcacggccttaagatactgtttgtaggttataac
cctggagagcgctcggctgtgttagggcatcattttgccggtcgggggaatcagttttgg
cggctgctttatgaagcggggttaactccccggctttatgaccccacggaagacgggatg
ctgaaagaactgggttacggtctaaccaacctggtcccgagacccagtaaaagcagttcc
gacctctcaaccgccgagatgcgggagggagcgctggaattgaggataaaggtgacccga
tataagccggcgattgtttgttttctgggcaaagaggtttaccggcggtttgccggtatc
tcagccaagagcggcctttcatacggtccggtagaaggagcggatgtaactcagggagtc
ctagcctttgttgcgcccaaccccagtggcaggagtaccattctttacgccgataaatta
gctgtgtttattcaacttcagaccatggtaaaagcacaaaaattaaggaaagataaatcc
aaagcacttggctaa

DBGET integrated database retrieval system