KEGG   Desulfotomaculum ruminis: Desru_1354Help
Entry
Desru_1354        CDS       T01518                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dru  Desulfotomaculum ruminis
Pathway
dru00010  Glycolysis / Gluconeogenesis
dru00030  Pentose phosphate pathway
dru00051  Fructose and mannose metabolism
dru00052  Galactose metabolism
dru00680  Methane metabolism
dru01100  Metabolic pathways
dru01110  Biosynthesis of secondary metabolites
dru01120  Microbial metabolism in diverse environments
dru01130  Biosynthesis of antibiotics
dru01200  Carbon metabolism
dru01230  Biosynthesis of amino acids
dru03018  RNA degradation
Module
dru_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dru00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Desru_1354
   00030 Pentose phosphate pathway
    Desru_1354
   00051 Fructose and mannose metabolism
    Desru_1354
   00052 Galactose metabolism
    Desru_1354
  Energy metabolism
   00680 Methane metabolism
    Desru_1354
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Desru_1354
Enzymes [BR:dru01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Desru_1354
Protein phosphatases and associated proteins [BR:dru01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Desru_1354
Messenger RNA biogenesis [BR:dru03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Desru_1354
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat GDI
Motif
Other DBs
NCBI-ProteinID: AEG59627
UniProt: F6DPQ0
LinkDB All DBs
Position
1373120..1374082
Genome map
AA seq 320 aa AA seqDB search
MQRIGVLTSGGDAPGMNSCIRAVVRKAIYHGMEVIGIKRGYSGFIDADMGPMNLGSVADI
IHRGGTILHTARSQRFQTKEGRAQAMENVRRFGIQGLVVIGGDGSFTGASIFHQEHGIPV
VGVPGTIDNDISGTDYTIGFDTALNNVVDAINKIRDTATSHERTFVIEVMGRNSGNIALA
AGLAGGAESILVPEILFNIEDICHKLLSGHKRGKLHSIILVAEGAASGLTIGQQIKDLTG
FDTKVTILGHLQRGGIPSAFDRILAARLGAKAVELLMAGDSGKMVGVRSGEVVASDLQEI
LGKPCPINDEMYQLAKILSI
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgcagagaataggcgtcttaaccagcggcggagatgcgccgggaatgaattcctgcatt
cgggcagtggttcgcaaggccatctatcatggcatggaagtgattggaattaaacgggga
tacagtggttttattgatgccgatatgggtcccatgaatcttggctcagtggcggatatt
atccaccggggaggaaccattttacatacggcccggtcccagcgcttccagaccaaggaa
ggccgcgctcaggccatggagaacgtccggcgctttggcattcagggattggtggtcatc
ggcggggacggttcttttaccggcgccagcatctttcatcaggaacacggaattccggtg
gtgggggttcccgggaccattgacaatgatatcagcggtacggattataccattggtttt
gatacagccctaaacaatgtagtggatgccattaataaaatccgggatacggccacctcc
catgaaagaacctttgtcattgaggttatgggtcgaaattcgggcaatattgccctggcc
gccgggctggccggcggggccgaaagcatcctggttcctgaaattctctttaatattgaa
gacatttgccataagctgttaagcggacataaacggggtaaactacactccatcatcctg
gttgccgaaggagctgccagcggtttaaccattggccaacaaattaaggatttgaccggc
tttgataccaaagtaaccattctgggccatctgcagcggggcggtattccttccgccttt
gaccggattttggcagcccggctgggagcaaaggccgtagagcttttaatggccggggat
agcggcaaaatggttggcgtccgctccggagaagtggttgcctcggatttgcaggaaata
ctggggaaaccctgccccatcaatgacgagatgtaccaactggccaaaatactttcaatt
tag

DBGET integrated database retrieval system