KEGG   Desulfotomaculum ruminis: Desru_1861Help
Entry
Desru_1861        CDS       T01518                                 

Definition
(GenBank) DNA polymerase LigD, polymerase domain protein
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
dru  Desulfotomaculum ruminis
Pathway
dru03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:dru00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    Desru_1861
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:dru03400]
    Desru_1861
Enzymes [BR:dru01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Desru_1861
DNA repair and recombination proteins [BR:dru03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     Desru_1861
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AEG60122
UniProt: F6DU47
LinkDB All DBs
Position
1877227..1878141
Genome map
AA seq 304 aa AA seqDB search
MAAKGSTEVSINGRVLKLTNLDKQLWPEGLTKAHLVKYYTDIAPYLLPLIKDRPLVMKRY
PHGIEGEYFYQKECPEYAPEWIHKEKISHSGKDVRYVICNDLPTLIWLINQGCIEIHGWL
SKRGAIEYPDVAVIDLDPGKDVSFQGVMEVALVVKKTLDQLGLKGFPKTSGASGIHVFIP
LEPGYTFREATKAMGWVAKLVTGAFPEKATIERVLTKRRPDKVYVDYLQNTRGKTMAWTY
SLRPLPGAPVSTPLLWEEIEKFSIHPAQFTMDSIFHRIKIFGDIAAAMNLQRQTLDSIRP
MVSF
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggccgcaaaaggttccaccgaggtttccattaacggaagagtgcttaagcttaccaat
ctggataaacaattgtggcccgaggggttgaccaaagcgcatctggtaaagtattatacg
gacattgcgccatacctgttgcccctaattaaggatcgtcctctggtgatgaaaagatat
ccccacggcatcgaaggggaatatttttatcaaaaagaatgtccggaatatgcgcccgaa
tggatccacaaggaaaaaatttcccattcggggaaagatgtccgatacgttatttgcaat
gacctgccgacattgatctggctgatcaaccaagggtgcattgagattcatggctggctg
tccaaaagaggagccattgaatatccggatgtggctgtcattgatttggaccctggcaag
gatgtttctttccagggggttatggaagtggccctggtggttaaaaaaaccctggatcag
ctcggtttaaaaggttttcccaaaacctccggcgccagcggcattcatgtttttattccc
ttagaaccaggatatactttccgggaggcaaccaaggccatgggctgggtcgccaagctg
gtaaccggagcctttcctgaaaaggccaccattgagagggtactgaccaaaaggagaccg
gataaggtttatgtggattatttacaaaatacccggggcaaaaccatggcctggacctac
agtctgcggccgctgccgggcgcaccggtttccacaccgttgttatgggaggaaattgaa
aaattttcaattcatcccgcccaatttaccatggactccatttttcaccgtataaaaatc
tttggcgacattgctgctgccatgaatttgcagaggcaaaccttggattctataaggcca
atggtctcattttaa

DBGET integrated database retrieval system