KEGG   Desulfotomaculum ruminis: Desru_3134Help
Entry
Desru_3134        CDS       T01518                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
dru  Desulfotomaculum ruminis
Pathway
dru00040  Pentose and glucuronate interconversions
dru00051  Fructose and mannose metabolism
dru01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dru00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Desru_3134
   00051 Fructose and mannose metabolism
    Desru_3134
Enzymes [BR:dru01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     Desru_3134
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 TrkA_N ADH_N_assoc 2-Hacid_dh_C AlaDh_PNT_C FtsJ
Motif
Other DBs
NCBI-ProteinID: AEG61345
UniProt: F6DUU8
LinkDB All DBs
Position
complement(3195790..3196830)
Genome map
AA seq 346 aa AA seqDB search
MEKMKAGILYGSGDVRVEEVPVPRIKPDEALVKIKAVGVCGSDVHYYEHGKIGRYVVEEP
MILGHEAGGEIMAVGEDVAGLKVGQRVAIEPGVTCGKCKFCKEGRYNLCPDVVFLATPPV
DGAFCEYLAMRGDFLHPIPDHMSYEAASLVEPFSVGLHACKRAGVKPGDTVAVLGLGPVG
QLAVVAARAFGATKIIAVDLAPIRLQMAGEMGATTVINAGEQDVYEAIMKETGGVGVDVA
LETAGSTATNLMAVRVARRGGKVALVGLPPQPEVPFNVFDIADGELDIFGIFRYANTYPR
AVELLASGIAPVEKLVTHRFALEQAKEALDLARTDKQGSIKVMVNL
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggagaaaatgaaagccggtattctttacggatccggagatgttcgggtagaagaggtc
ccggtgccccggattaaacccgacgaggcgctggtaaagattaaagccgtgggggtttgc
ggttccgacgtgcactattatgagcacggcaaaataggccgttatgtagtggaagaaccg
atgattcttgggcacgaggccggtggcgaaatcatggcggtaggcgaggatgttgccggt
cttaaagtggggcagcgggtagccattgagcccggtgttacctgcggcaagtgcaaattc
tgcaaagagggccgctataatttgtgtccggacgtggtattcctggccactcctccggtg
gatggcgccttctgcgaatatctggccatgcggggggattttctgcatcccattcccgat
catatgagctatgaagcggcttccctggttgaacccttttccgtggggctgcacgcctgc
aagcgggccggggtaaaacccggggataccgtggcggttttaggcctgggccccgtgggg
caactggcggtggtggctgccagggcttttggcgccaccaaaatcattgctgtggatctg
gcccccatccggctgcagatggccggggaaatgggcgccaccacggtgattaacgccggg
gaacaggatgtctatgaggccatcatgaaggaaaccgggggcgttggtgtggatgtggcc
ctggagacagccggcagtacggccaccaatttaatggctgtgcgggtggcccgccgggga
ggtaaggtggccctggtaggactgccgccccagccggaagttccttttaatgtatttgat
attgccgatggcgaattagatatctttggtattttccgctatgccaatacctatccccgg
gcggttgaactgttggccagcggtattgccccggtggaaaagctggtcacgcaccggttt
gccctggaacaggccaaggaagccctggatctggccaggaccgataagcagggcagtatt
aaagtcatggtcaacctgtaa

DBGET integrated database retrieval system